KEGG   Addendum: ADB04305
Entry
ADB04305          CDS       T10000                                 

Gene name
bnsF
Definition
(KEGG) naphthyl-2-methylsuccinate CoA transferase subunit
  KO
K15570  naphthyl-2-methylsuccinate CoA transferase subunit [EC:2.8.3.-]
Taxonomy
TAX:700510
  Lineage
Bacteria; environmental samples
Organism
ag  Addendum (bacterium enrichment culture clone N47)
SSDB
Motif
Pfam: CoA_transf_3
Other DBs
NCBI-ProteinID: ADB04305
GB: GU080108
UniProt: D2XBI6
LinkDB
AA seq 409 aa
MLRSLKKCLEGIVVCDFSWVGAGPITTNVLGQCGAEVIKIESKKRPDILRKGGPFKDGIG
SGLERSGYFANRNPNKKSISLDMGHPKARDVAVRLIEKSDIIINNFRVGQMEKWNLGWED
LKEINPRIIYVTMSLQGTSGPHKSYMGYGVNLNALCGLTARAGFPGEKPFGTGTNYTDHV
MVPCHTLFGILAALLDREFTGKGQIVSISQLESAICMKPTDILAYGANGEILGPLGYGDP
DAAPHGAYTTLGYRKWIAIAVFGEDEWGAFKKVMGSPHWAEDHKFSTFSERKKNEAELDS
LIEEWTKTLYADWLMEVLSRNGVRAGIINDARGAVEDEHLREREFWVYLNHPVVGSSLYN
RAPFCFSKTPVRMEKAAPILGQDTHSVLTGMLDYSEEEVDQLVSDEVLV
Comment
Incomplete sequence.
Reference
  Authors
Selesi D, Jehmlich N, von Bergen M, Schmidt F, Rattei T, Tischler P, Lueders T, Meckenstock RU
  Title
Combined genomic and proteomic approaches identify gene clusters involved in anaerobic 2-methylnaphthalene degradation in the sulfate-reducing enrichment culture N47.
  Journal
J Bacteriol 192:295-306 (2010)
DOI:10.1128/JB.00874-09

DBGET integrated database retrieval system