KEGG   Addendum: ADB04306
Entry
ADB04306          CDS       T10000                                 

Gene name
bnsE
Definition
(KEGG) naphthyl-2-methylsuccinate CoA transferase subunit
  KO
K15569  naphthyl-2-methylsuccinate CoA transferase subunit [EC:2.8.3.-]
Taxonomy
TAX:700510
  Lineage
Bacteria; environmental samples
Organism
ag  Addendum (bacterium enrichment culture clone N47)
SSDB
Motif
Pfam: CoA_transf_3
Other DBs
NCBI-ProteinID: ADB04306
GB: GU080109
UniProt: D2XBI7
LinkDB
AA seq 427 aa
MSKKNKLRVLEGENMGENGGSLSDIRVLDFTGELGPYAAKMYAGLGADVIHLEPIDGDPL
RKCGPFFKGIPGRERGLQFLYYNADKKGMPLDLRNEKGREIFVELCRRADLLLESFTPGF
LEGVGLSYDVLSTVNPKLVQTSITPFGQFGPYSKYPGSDLTCSALGGFLFLAGVGNDKPV
RASDNQAYRMAEAYAAVGSSIALYFAKKTGIGQFVDVAGIESVGMALENAAQFWDLEGTN
RRGLGRIAGGGIIHPCKDGYVVVVAIMGRNKPMWEPFVKWMKEEAVDEWEIFDDDKWIDV
DYRASAEGYELFCRIFERYSMQHEKAYIYDKGQAHRVAVSPVSDGKDLLENPQLKYRNFW
KTLHHDTLQGDVVYPGAPYEFGNLKWELRNPAPSFGQHTAEILAECGYTKNDITLLAKEG
VVYVAES
Comment
Incomplete sequence.
Reference
  Authors
Selesi D, Jehmlich N, von Bergen M, Schmidt F, Rattei T, Tischler P, Lueders T, Meckenstock RU
  Title
Combined genomic and proteomic approaches identify gene clusters involved in anaerobic 2-methylnaphthalene degradation in the sulfate-reducing enrichment culture N47.
  Journal
J Bacteriol 192:295-306 (2010)
DOI:10.1128/JB.00874-09

DBGET integrated database retrieval system