KEGG   Addendum: ADC31797
Entry
ADC31797          CDS       T10000                                 

Gene name
carC
Definition
(KEGG) 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase
  KO
K15756  2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase [EC:3.7.1.13]
Taxonomy
TAX:411925
  Lineage
Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales; Sphingomonadaceae; Sphingomonas
Organism
ag  Addendum (Sphingomonas sp. XLDN2-5)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DUF1057 Esterase Peptidase_S9 FSH1
Other DBs
NCBI-ProteinID: ADC31797
GB: GU123624
UniProt: D5IGG3
LinkDB
AA seq 274 aa
MVLAATAGRSVTVRGMETYYHEQGSGDVVVLVHGGGAGADSMGNWRGVMPVLADRYRVIA
VDMLGFGRTAKPADPFVFSQAARTDHLAGFLDALGLSNVALVGNSMGGASALGVAVERPG
LVRKLVLMGSAGLVSKIDPALEPVLGYDFTREGMIRLVRALTTDNFQIDDAMIDYRYALS
VDPETRRAYSATMQWIRDQGGLYYEDDYIRRITAPTLIVNGKLDKVVPLANAYKFLELIG
PSWGYIMPDCGYWAMIEHPVDFARTTAAFIEAAQ
Reference
  Authors
Gai Z, Wang X, Liu X, Tai C, Tang H, He X, Wu G, Deng Z, Xu P
  Title
The genes coding for the conversion of carbazole to catechol are flanked by IS6100 elements in Sphingomonas sp. strain XLDN2-5.
  Journal
PLoS One 5:e10018 (2010)
DOI:10.1371/journal.pone.0010018

DBGET integrated database retrieval system