KEGG   Addendum: ADN39487
Entry
ADN39487          CDS       T10000                                 

Gene name
ddaG
Definition
(KEGG) fumarate---(S)-2,3-diaminopropanoate ligase (EC:6.3.2.46)
  KO
K22113  fumarate---(S)-2,3-diaminopropanoate ligase [EC:6.3.2.46]
Taxonomy
TAX:549
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Erwiniaceae; Pantoea; Pantoea agglomerans group
Organism
ag  Addendum (Pantoea agglomerans)
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-ProteinID: ADN39487
GB: HQ130277
UniProt: E2JA32
LinkDB
AA seq 396 aa
MNKGENMNLEMWVQNISATFPWYAQLLRDKQADLSRLESLPLITEELLTQHYYHAENSFP
GEHHSYLTSGTTSGKRKRIFYSDNDQRIYLQQRMDIIRDFCGEGHTRACADLGTGHAAAT
AGEIFQAMGCDVELIDFTRPIEQHIEVLNRFKPDIFFTMPMILDSLIATGKLDFQPKRII
LLGDVASLNWQNKVADYFHIQPAQVLDLFGSIEIGSIAFYNHAQKRYQFDSYVRPEVVPV
QSLYPGAKYGGDGGILLLTSFAREYFPAVRFVTNDLIEGFAQENVGGRTVYTYQRCLGRF
AGEFKHGEKINLSDISDALANNLPYHKYDLADHEGGLVIRIAAKSIPTEVIEAIKHDLLA
RNPDIAQMISSGLVGDIRIQCVDAQEITGNVSKRRY
Reference
  Authors
Hollenhorst MA, Clardy J, Walsh CT
  Title
The ATP-dependent amide ligases DdaG and DdaF assemble the fumaramoyl-dipeptide scaffold of the dapdiamide antibiotics.
  Journal
Biochemistry 48:10467-72 (2009)
DOI:10.1021/bi9013165
Reference
  Authors
Dawlaty J, Zhang X, Fischbach MA, Clardy J
  Title
Dapdiamides, tripeptide antibiotics formed by unconventional amide ligases.
  Journal
J Nat Prod 73:441-6 (2010)
DOI:10.1021/np900685z

DBGET integrated database retrieval system