KEGG   Addendum: AEG79727Help
Entry
AEG79727          CDS       T10000                                 

Gene name
CYP71BL3, COS
Definition
(KEGG) costunolide synthase (EC:1.14.14.150)
  KO
K20561  costunolide synthase [EC:1.14.14.150]
Taxonomy
TAX:13427
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Cichoriinae; Cichorium
Organism
ag  Addendum (Cichorium intybus)
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: AEG79727
GB: JF816041
UniProt: G3GBK0
LinkDB All DBs
AA seq 494 aa AA seqDB search
MEPLTIVSLVVASLFLFAFWALSPKTSKNLPPGPPKLPIIGNIHQLKSPTPHRVLRNLAR
KYGPIMHLQLGQVSTVVVSTPRLAREIMKTNDISFADRPTTTTSQIFFYKAQDIGWAPYG
EYWRQMKKICTLELLSAKKVRSFSSIREEELSRISKVLESQAGTPINFTEMTVEMVNNVI
CKATLGDSCKDQATLIEVLYDVLKTLSAFNLASYYPGLQFLNVILGKKAKWLKMQKQLDD
ILEDVLKEHRSKGSNKSDQEDLVDVLLRVKDTGGLDFTVTDEHVKAVVLDMLTAGTDTSS
ATLEWAMTELMRNPHMMKRAQDEVRSVVKGNTITETDLQSLHYLKLIVKETLRLHAPTPL
LVPRECRQDCNVDGYDIPAKTKILVNAWACGTDPDSWKDPESFIPERFENCPINYMGADF
EFIPFGAGRRICPGLTFGLSMVEYPLANFLYHFDWKLPNGLKPHELDITEITGISTSLKH
QLKIVPMIPKSIAK
Reference
  Authors
de Kraker JW, Franssen MC, Joerink M, de Groot A, Bouwmeester HJ
  Title
Biosynthesis of costunolide, dihydrocostunolide, and leucodin. Demonstration of cytochrome p450-catalyzed formation of the lactone ring present in sesquiterpene lactones of chicory.
  Journal
Plant Physiol 129:257-68 (2002)
DOI:10.1104/pp.010957
Reference
  Authors
Liu Q, Majdi M, Cankar K, Goedbloed M, Charnikhova T, Verstappen FW, de Vos RC, Beekwilder J, van der Krol S, Bouwmeester HJ
  Title
Reconstitution of the costunolide biosynthetic pathway in yeast and Nicotiana benthamiana.
  Journal
PLoS One 6:e23255 (2011)
DOI:10.1371/journal.pone.0023255

DBGET integrated database retrieval system