KEGG   Addendum: AFB74620
Entry
AFB74620          CDS       T10000                                 

Gene name
AT1
Definition
(KEGG) 1,13-dihydroxy-N-methylcandine 13-O-acetyltransferase
  KO
K22095  (13S,14R)-1,13-dihydroxy-N-methylcandine 13-O-acetyltransferase [EC:2.3.1.285]
Taxonomy
TAX:3469
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Ranunculales; Papaveraceae; Papaveroideae; Papaver
Organism
ag  Addendum (Papaver somniferum)
SSDB
Motif
Pfam: Transferase
Other DBs
NCBI-ProteinID: AFB74620
GB: JQ659008
UniProt: I3PLR4
LinkDB
AA seq 471 aa
MATMSSAAVEVISKETIKPRNPTPYQLRNYNMSLLDQYSSLVYVPIILFYPAASDANSTG
SKHHDDLHLLKRSLSETLVHFYPMAGRMKDNMTVDCNDEGIDFFEVRIKGRMCDFMMKSD
AHLSLLLPSEVASTNFVKEAQVIVQVNMFDCGGTAICFCISNKIADACTMITFIRSLAGT
TNIARRGSSIAAPTTNQNLVPSFDSTSLFPPSEQLASQVSYPTQDSTSVDKLVSKRFVFD
AAKITSAREKLQSLMHDKYKCHRPTRVEVVSALIWKSAVKSAPPGSISTVTHAMNFRKKM
DPPLQDASFGNLCVVVTAVLPATTATTTNPATKKVSSTSNEEQVALDELSDFVALLRREI
DKVKGDKGCMEKIIQKFIYGHDASVAKDSDVEDKVTALFMTSWCKFGFYEADFGWGTPVW
VTTVPLIEPKYKNMVFMNDMKCGEGIEVWVNFLEDDMTKFEHHLREILQLF
Reference
  Authors
Winzer T, Gazda V, He Z, Kaminski F, Kern M, Larson TR, Li Y, Meade F, Teodor R, Vaistij FE, Walker C, Bowser TA, Graham IA
  Title
A Papaver somniferum 10-gene cluster for synthesis of the anticancer alkaloid noscapine.
  Journal
Science 336:1704-8 (2012)
DOI:10.1126/science.1220757

DBGET integrated database retrieval system