KEGG   Addendum: AFV52151
Entry
AFV52151          CDS       T10000                                 

Gene name
kedN3
Definition
(KEGG) cytochrome P450 monooxygenase
  KO
K21222  cytochrome P450 monooxygenase [EC:1.14.-.-]
Taxonomy
TAX:756733
  Lineage
Bacteria; Actinobacteria; Pseudonocardiales; Pseudonocardiaceae; Streptoalloteichus; unclassified Streptoalloteichus
Organism
ag  Addendum (Streptoalloteichus sp. ATCC 53650)
Module
756733_M00831  Kedarcidin 2-hydroxynaphthoate moiety biosynthesis, malonyl-CoA => 3,6,8-trihydroxy-2-naphthoate => 3-hydroxy-7,8-dimethoxy-6-isopropoxy-2-naphthoyl-CoA
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AFV52151
GB: JX679499
UniProt: K4PC27
LinkDB
AA seq 408 aa
MAPNTPVALDVNGSDIHAEAAALRAQAPAVRVTLPGGVTAWSVTSHAAIKSILTDPRVTK
SARNHWPDFIEGRVPGDWELISWVAMDNMVTAYGKDHVRLRRLVGKAFTRRRTESIQPRV
VELTEGLLGALAATPPGEVVDLRERFAYPLPAMLVADLIGMSEQARAATAKVIDMMVDTT
VTPEQAQAVLQGWRGAMSDLIAEKRRTPGDDITSDLIAARDEDGSRLSEQEMADSIFAIL
GAGSETTINFFDNAITALLTHPEQRDLVLSGQASWDDVIDETLRVQSPLASLPLRYAVED
IRLDEVTIPKGDPILVNYAAVGRDPALHGGTADDFDITRADKEHLSFGHGPHYCLGVGIA
RMVGTIGLSTLFERFPDMRLAVSVEELQPLPTFIMNGHRALPVRLTSG
Reference
  Authors
Lohman JR, Huang SX, Horsman GP, Dilfer PE, Huang T, Chen Y, Wendt-Pienkowski E, Shen B
  Title
Cloning and sequencing of the kedarcidin biosynthetic gene cluster from Streptoalloteichus sp. ATCC 53650 revealing new insights into biosynthesis of the enediyne family of antitumor antibiotics.
  Journal
Mol Biosyst 9:478-91 (2013)
DOI:10.1039/c3mb25523a
Reference
  Authors
Huang SX, Lohman JR, Huang T, Shen B
  Title
A new member of the 4-methylideneimidazole-5-one-containing aminomutase family from the enediyne kedarcidin biosynthetic pathway.
  Journal
Proc Natl Acad Sci U S A 110:8069-74 (2013)
DOI:10.1073/pnas.1304733110

DBGET integrated database retrieval system