KEGG   Addendum: AGC29953Help
Entry
AGC29953          CDS       T10000                                 

Gene name
CYP719A23
Definition
(KEGG) (-)-pluviatolide synthase (EC:1.14.19.72)
  KO
K21207  (-)-pluviatolide synthase [EC:1.14.19.72]
Taxonomy
TAX:93608
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; Ranunculales; Berberidaceae; Podophylloideae; Sinopodophyllum
Organism
ag  Addendum (Sinopodophyllum hexandrum)
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: AGC29953
GB: KC110997
UniProt: L7T8H2
LinkDB All DBs
AA seq 489 aa AA seqDB search
MEMEMSVLAMSSTLILALAMALIFLFKAKSSSAIKWPPGPKTLPIIGNLHQLGGDELHIV
LAKLARVHGAIMTIWMAKKPVIVVSDVNSVWEVLVSKSSDYAARDAAEISKIVSASSHSI
NTSDSGPYWQTLRRGLTHGPLGPLNISAQIPIQQRDMQRVIREMQQDAAANGGIIKPLDH
LKRSSTRLVSRLIFGDTFDNDPYNDSMHEVVQDLNRFGGIALLEQAFSFAKHLPSYKRGV
KEFHIHKRKIDDLVRPVVASANPPSNSYLGFLQSQNYSEEIIIACIFELYLLAMDSSAST
ATWALAFMIRDQQVQEKLYQDIKRVIGDGVDLVKAEDLSKMHYLQAVVKETMRMKPIAPL
AIPHKTAIDTTVMGTKVPKGTCVMVNLYALHHDESVWAKPYTFMPERFLQGEDGKSVTEQ
AFLPFGAGMRICGGMEVGKLQFSLALANLVNAFKWTSAAEGKLPDMSDELQFITVMKTPL
EARIIPRNP
Reference
  Authors
Marques JV, Kim KW, Lee C, Costa MA, May GD, Crow JA, Davin LB, Lewis NG
  Title
Next generation sequencing in predicting gene function in podophyllotoxin biosynthesis.
  Journal
J Biol Chem 288:466-79 (2013)
DOI:10.1074/jbc.M112.400689

DBGET integrated database retrieval system