KEGG   Addendum: AIU56747Help
Entry
AIU56747          CDS       T10000                                 

Gene name
CYP71B41v2
Definition
(KEGG) aldoxime dehydratase
  KO
K01773  aldoxime dehydratase [EC:4.99.1.-]
Taxonomy
TAX:3694
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Organism
ag  Addendum (Populus trichocarpa)
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: AIU56747
GB: KM458849
UniProt: A0A097PUC0
LinkDB All DBs
AA seq 507 aa AA seqDB search
MALYVVPLWLPLILLLALLLLFMKKMEVKRQSEQLLPPSPPKLPILGNLHQLGSLPHQSL
WQLSKKYGPVMLIRLGRIPTVVISSAEAAREVLKVHDVAFCSRPLLAGTGRLTYNYLDIA
FSPYSDHWRNMRKILTLELFSLKRVQSFRFIREEEVSLLVNFISESSALAAPVDLTQKLY
ALVANITFRMAYGFNYRGTSFDRDKFHEVVHDTVAVVGSISADESIPYLGWIVDRLTGHR
ARTERVFHEVDTFFQHLIDNHLKPGRIKEHDDMVDVLLRIEKEQTELGASQFTKDNIKAI
LLNLFLGGVDTSSLTVNWAMAELVRNPRVMKKVQDEVRKCVGNKGRVTESDIDQLEYLRM
VIKETLRLHPPAPLLIPRETMSHCKVSGHNIYPKMLVQINVWAIGRDPTYWKDPEEFFPE
RFLDSSIDYKGQSFEYLPFGSGRRICPGMHMGFITMEIILANLLFCFDWVFPDGMKKEDI
NMEEKAGVSLTTSKKTPLILVPVNYLQ
Reference
  Authors
Irmisch S, Clavijo McCormick A, Gunther J, Schmidt A, Boeckler GA, Gershenzon J, Unsicker SB, Kollner TG
  Title
Herbivore-induced poplar cytochrome P450 enzymes of the CYP71 family convert aldoximes to nitriles which repel a generalist caterpillar.
  Journal
Plant J 80:1095-107 (2014)
DOI:10.1111/tpj.12711

DBGET integrated database retrieval system