KEGG   Addendum: BAA32492
Entry
BAA32492          CDS       T10000                                 

Gene name
fomD
Definition
(KEGG) HPP-CMP hydrolase
  KO
K24000  HPP-CMP hydrolase [EC:3.6.1.-]
Taxonomy
TAX:43759
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces wedmorensis)
Module
43759_M00903  Fosfomycin biosynthesis, phosphoenolpyruvate => fosfomycin
SSDB
Motif
Pfam: DUF402
Other DBs
NCBI-ProteinID: BAA32492
GB: AB016934
UniProt: O83033
LinkDB
AA seq 209 aa
MAEVASQETEFAAFAFGSVVERRDELEGRPWISYPVRVVADTPELVAVYLSHGTLLTFGD
GPFSWGPHPWGPFGDRWQSAGILQLHRPGRGHSVWVLRDADTGAFREWYVNVEAPWRRTP
TGFSTLDHEIDLVVPADSRTLRWKDVEKFEERARIGHFSPEEATAIRTEAADVAREIAAG
EQWWDTSWSRWEPPAGWHALLQSFETEGS
Reference
PMID:7500951
  Authors
Hidaka T, Goda M, Kuzuyama T, Takei N, Hidaka M, Seto H
  Title
Cloning and nucleotide sequence of fosfomycin biosynthetic genes of Streptomyces wedmorensis.
  Journal
Mol Gen Genet 249:274-80 (1995)
DOI:10.1007/BF00290527
Reference
  Authors
Sato S, Kudo F, Kim SY, Kuzuyama T, Eguchi T
  Title
Methylcobalamin-Dependent Radical SAM C-Methyltransferase Fom3 Recognizes Cytidylyl-2-hydroxyethylphosphonate and Catalyzes the Nonstereoselective C-Methylation in Fosfomycin Biosynthesis.
  Journal
Biochemistry 56:3519-3522 (2017)
DOI:10.1021/acs.biochem.7b00472
Reference
  Authors
Blaszczyk AJ, Booker SJ
  Title
A (Re)Discovery of the Fom3 Substrate.
  Journal
Biochemistry 57:891-892 (2018)
DOI:10.1021/acs.biochem.7b01281

DBGET integrated database retrieval system