| Entry |
|
|---|
| Gene name |
fomD
|
|---|
| Definition |
|
|---|
| KO |
| K24000 | HPP-CMP hydrolase [EC:3.6.1.-] |
|
|---|
| Taxonomy |
|
|---|
| Lineage |
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces |
|---|
| Organism |
ag Addendum (Streptomyces wedmorensis)
|
|---|
| Module |
| 43759_M00903 | Fosfomycin biosynthesis, phosphoenolpyruvate => fosfomycin |
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| LinkDB |
|
|---|
| AA seq |
209 aa
MAEVASQETEFAAFAFGSVVERRDELEGRPWISYPVRVVADTPELVAVYLSHGTLLTFGD
GPFSWGPHPWGPFGDRWQSAGILQLHRPGRGHSVWVLRDADTGAFREWYVNVEAPWRRTP
TGFSTLDHEIDLVVPADSRTLRWKDVEKFEERARIGHFSPEEATAIRTEAADVAREIAAG
EQWWDTSWSRWEPPAGWHALLQSFETEGS |
|---|
| Reference |
|
|---|
| Authors |
Hidaka T, Goda M, Kuzuyama T, Takei N, Hidaka M, Seto H |
|---|
| Title |
Cloning and nucleotide sequence of fosfomycin biosynthetic genes of Streptomyces wedmorensis. |
|---|
| Journal |
|
|---|
| Reference |
|
|---|
| Authors |
Sato S, Kudo F, Kim SY, Kuzuyama T, Eguchi T |
|---|
| Title |
Methylcobalamin-Dependent Radical SAM C-Methyltransferase Fom3 Recognizes Cytidylyl-2-hydroxyethylphosphonate and Catalyzes the Nonstereoselective C-Methylation in Fosfomycin Biosynthesis. |
|---|
| Journal |
|
|---|
| Reference |
|
|---|
| Authors |
Blaszczyk AJ, Booker SJ |
|---|
| Title |
A (Re)Discovery of the Fom3 Substrate. |
|---|
| Journal |
|
|---|
