KEGG   Addendum: BAB12024
Entry
BAB12024          CDS       T10000                                 

Gene name
PNO
Definition
(KEGG) pyruvate dehydrogenase (NADP+) (EC:1.2.1.51)
  KO
K21682  pyruvate dehydrogenase (NADP+) [EC:1.2.1.51]
Taxonomy
TAX:3039
  Lineage
Eukaryota; Discoba; Euglenozoa; Euglenida; Spirocuta; Euglenophyceae; Euglenales; Euglenaceae; Euglena
Organism
ag  Addendum (Euglena gracilis)
SSDB
Motif
Pfam: POR_N FAD_binding_1 Flavodoxin_1 POR EKR TPP_enzyme_C PFOR_II NAD_binding_1 Fer4_7 Fer4_21 Fer4_9 Fer4_10 Fer4_16 Fer4 Fer4_17 Fer4_8 Fer4_6 Fer4_4 Flavodoxin_3 Fer4_2 APP_E2
Other DBs
NCBI-ProteinID: BAB12024
GB: AB021127
UniProt: Q94IN5
LinkDB
AA seq 1803 aa
MKQSVRPIISNVLRKEVALYSTIIGQDKGKEPTGRTYTSGPKPASHIEVPHHVTVPATDR
TPNPDAQFFQSVDGSQATSHVAYALSDTAFIYPITPSSVMGELADVWMAQGRKNAFGQVV
DVREMQSEAGAAGALHGALAAGAIATTFTASQGLLLMIPNMYKIAGELMPSVIHVAAREL
AGHALSIFGGHADVMAVRQTGWAMLCSHTVQQSHDMALISHVATLKSSIPFVHFFDGFRT
SHEVNKIKMLPYAELKKLVPPGTMEQHWARSLNPMHPTIRGTNQSADIYFQNMESANQYY
TDLAEVVQETMDEVAPYIGRHYKIFEYVGAPDAEEVTVLMGSGATTVNEAVDLLVKRGKK
VGAVLVHLYRPWSTKAFEKVLPKTVKRIAALDRCKEVTALGEPLYLDVSATLNLFPERQN
VKVIGGRYGLGSKDFIPEHALAIYANLASENPIQRFTVGITDDVTGTSVPFVNERVDTLP
EGTRQCVFWGIGSDGTVGANRSAVRIIGDNSDLMVQAYFQFDAFKSGGVTSSHLRFGPKP
ITAQYLVTNADYIACHFQEYVKRFDMLDAIREGGTFVLNSRWTTEDMEKEIPADFRRKLA
QKKVRFYNVDARKICDSFGLGKRINMLMQACFFKLSGVLPLAEAQRLLNESIVHEYGKKG
GKVVEMNQAVVNAVFAGDLPQEVQVPAAWANAVDTSTRTPTGIEFVDKIMRPLMDFKGDQ
LPVSVMTPGGTFPVGTTQYAKRAIAAFIPQWIPANCTQCNYCSYVCPHATIRPFVLTDQE
VQLAPESFVTRKAKGDYQGMNFRIQVAPEDCTGCQVCVETCPDDALEMTDAFTATPVQRT
NWEFAIKVPNRGTMTDRYSLKGSQFQQPLLEFSGACEGCGETPYVKLLTQLFGERTVIAN
ATGCSSIWGGTAGLAPYTTNAKGQGPAWGNSLFEDNAEFGFGIAVANAQKRSRVRDCILQ
AVEKKVADEGLTTLLAQWLQDWNTGDKTLKYQDQIIAGLAQQRSKDPLLEQIYGMKDMLP
NISQWIIGGDGWANDIGFGGLDHVLASGQNLNVLVLDTEMYSNTGGQASKSTHMASVAKF
ALGGKRTNKKNLTEMAMSYGNVYVATVSHGNMAQCVKAFVEAESYDGPSLIVGYAPCIEH
GLRAGMARMVQESEAAIATGYWPLYRFDPRLATEGKNPFQLDSKRIKGNLQEYLDRQNRY
VNLKKNNPKGADLLKSQMADNITARFNRYRRMLEGPNTKAAAPSGNHVTILYGSETGNSE
GLAKELATDFERREYSVAVQALDDIDVADLENMGFVVIAVSTCGQGQFPRNSQLFWRELQ
RDKPEGWLKNLKYTVFGLGDSTYYFYCHTAKQIDARLAALGAQRVVPIGFGDDGDEDMFH
TGFNNWIPSVWNELKTKTPEEALFTPSIAVQLTPNATPQDFHFAKSTPVLSITGAERITP
ADHTRNFVTIRWKTDLSYQVGDSLGVFPENTRSVVEEFLQYYGLNPKDVITIENKGSREL
PHCMAVGDLFTKVLDILGKPNNRFYKTLSYFAVDKAEKERLLKIAEMGPEYSNILSETYH
YADIFHMFPSARPTLQYLIEMIPNIKPRYYSISSAPIHTPGEVHSLVLIDTWITLSGKHR
TGLTCTMLEHLQAGQVVDGCIHPTAMEFPDHEKPVVMCAMGSGLAPFVAFLRDGSTLRKQ
GKKTGNMALYFGNRYEKTEFLMKEELKGHINDGLLTLRCAFSRDDPKKKVYVQDLIKMDE
KMMYDYLVVQKGSMYCCGSRSFIKPVQESLKHCFMKAGGLTAEQAENEVIDMFTTGRYNI
EAW
Reference
  Authors
Nakazawa M, Inui H, Yamaji R, Yamamoto T, Takenaka S, Ueda M, Nakano Y, Miyatake K
  Title
The origin of pyruvate: NADP+ oxidoreductase in mitochondria of Euglena gracilis.
  Journal
FEBS Lett 479:155-6 (2000)
DOI:10.1016/S0014-5793(00)01882-2
Reference
PMID:3110154
  Authors
Inui H, Ono K, Miyatake K, Nakano Y, Kitaoka S
  Title
Purification and characterization of pyruvate:NADP+ oxidoreductase in Euglena gracilis.
  Journal
J Biol Chem 262:9130-5 (1987)

DBGET integrated database retrieval system