KEGG   Addendum: BAB39215
Entry
BAB39215          CDS       T10000                                 

Gene name
XMT
Definition
(KEGG) 7-methylxanthosine synthase (EC:2.1.1.158)
  KO
K12729  7-methylxanthosine synthase [EC:2.1.1.158]
Taxonomy
TAX:13443
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Organism
ag  Addendum (Coffea arabica)
SSDB
Motif
Pfam: Methyltransf_7
Other DBs
NCBI-ProteinID: BAB39215
GB: AB048793
UniProt: Q9AVK0
LinkDB
AA seq 372 aa
MELQEVLRMNGGEGDTSYAKNSAYNQLVLAKVKPVLEQCVRELLRANLPNINKCIKVADL
GCASGPNTLLTVRDIVQSIDKVGQEKKNELERPTIQIFLNDLFPNDFNSVFKLLPSFYRK
LEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLQWLSQVPSGLVTELGISTNK
GSIYSSKASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCICKGVELDARNAID
LLEMAINDLVVEGHLEEEKLDSFNLPVYIPSAEEVKCIVEEEGSFEILYLETFKVLYDAG
FSIDDEHIKAEYVASSVRAVYEPILASHFGEAIIPDIFHRFAKHAAKVLPLGKGFYNNLI
ISLAKKPEKSDV
Reference
  Authors
Ogawa M, Herai Y, Koizumi N, Kusano T, Sano H
  Title
7-Methylxanthine methyltransferase of coffee plants. Gene isolation and enzymatic properties.
  Journal
J Biol Chem 276:8213-8 (2001)
DOI:10.1074/jbc.M009480200
Reference
  Authors
Mizuno K, Kato M, Irino F, Yoneyama N, Fujimura T, Ashihara H
  Title
The first committed step reaction of caffeine biosynthesis: 7-methylxanthosine synthase is closely homologous to caffeine synthases in coffee (Coffea arabica L.).
  Journal
FEBS Lett 547:56-60 (2003)
DOI:10.1016/S0014-5793(03)00670-7
Reference
  Authors
Uefuji H, Ogita S, Yamaguchi Y, Koizumi N, Sano H
  Title
Molecular cloning and functional characterization of three distinct N-methyltransferases involved in the caffeine biosynthetic pathway in coffee plants.
  Journal
Plant Physiol 132:372-80 (2003)
DOI:10.1104/pp.102.019679

DBGET integrated database retrieval system