KEGG   Addendum: BAC75664
Entry
BAC75664          CDS       T10000                                 

Gene name
MXMT2
Definition
(KEGG) theobromine synthase (EC:2.1.1.159)
  KO
K12730  theobromine synthase [EC:2.1.1.159]
Taxonomy
TAX:13443
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Organism
ag  Addendum (Coffea arabica)
SSDB
Motif
Pfam: Methyltransf_7
Other DBs
NCBI-ProteinID: BAC75664
GB: AB084126
UniProt: Q84PP7
LinkDB
AA seq 384 aa
MELQEVLHMNEGEGDTSYAKNASYNLALAKVKPFLEQCIRELLRANLPNINKCIKVADLG
CASGPNTLLTVRDIVQSIDKVGQEEKNELERPTIQIFLNDLFQNDFNSVFKLLPSFYRKL
EKENGRKIGSCLISAMPGSFYGRLFPEESMHFLHSCYSVHWLSQVPSGLVIELGIGANKG
SIYSSKASRPPVQKAYLDQFTKDFTTFLRIHSKELFSRGRMLLTCICKVDEYDEPNPLDL
LDMAINDLIVEGHLEEEKLASFNLPFFTPSAEEVKCIVEEEGSFEILYLETFKAHYDAGF
SIDDDYPVRSHFQVYGDEHIKAEYVASLIRSVYEPILASHFGEAIMPDLFHRLAKHAAKV
LHLGKGCYNNLIISLAKKPEKSDV
Reference
  Authors
Uefuji H, Ogita S, Yamaguchi Y, Koizumi N, Sano H
  Title
Molecular cloning and functional characterization of three distinct N-methyltransferases involved in the caffeine biosynthetic pathway in coffee plants.
  Journal
Plant Physiol 132:372-80 (2003)
DOI:10.1104/pp.102.019679

DBGET integrated database retrieval system