KEGG   Addendum: BAC76886
Entry
BAC76886          CDS       T10000                                 

Gene name
g2d
Definition
(KEGG) glucan 1,6-alpha-isomaltosidase (EC:3.2.1.94)
  KO
K20847  glucan 1,6-alpha-isomaltosidase [EC:3.2.1.94]
Taxonomy
TAX:1665
  Lineage
Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Arthrobacter
Organism
ag  Addendum (Arthrobacter globiformis)
SSDB
Motif
Pfam: Melibiase_C CBM_6 CBM_35
Other DBs
NCBI-ProteinID: BAC76886
GB: AB110787
UniProt: Q7WSN5
LinkDB
Structure
PDB: 
5AWO 5AWQ 5AWP

AA seq 636 aa
MMNLSRRTLLTTGSAATLAYALGMAGSAQAATAVTARPGVPVTAAPPLRLASRNSVFTRS
GAGPRYWNIYGYSFPHNAPIPENEWKVNIDWLAGNFADFGYDIACTDGWIEGSSRTTGNG
YITSYNDSWQHDWAYWANYLAARKMKLGVYYNPLWVHRAAVEDASKTVLGRPDVKIADLV
VPGDFFARDIGGNQLYWLDVTKSGAKEYVQGYVRYFKDLGVPYLRIDFLSWYEDGRDANI
GQVNAPHGRANYELALSWINEAAGEDMEVSLVMPHMFQDGSAELANGDLVRINADADKGG
WDRLSGMRQNWQDAWPNWANPFCGFTGWSHRNGRGQLILDGDFMRASTFASDEERKTMMN
LMVAAGSPLAIADTYQQIGNNAWVYTNKEVLQLNADGLVGKPLYRSATPFSKDPGSRDTE
RWAGQLPDGSWGVALFNRSDTETVTKTIDFAKDLGLATGGNVRDLWEHRNLGMDSRATAA
LAPHASAIFRVTPPKMHGTTRYPAAFAAWGGGAGFNYNHPGYDGNGFVDGLQAGSGSADP
LVTFAVQVPHRGSYAIRYRYANATGDTSTMTVTAEKADRSTVDGPVHVSFPGLATWDTWG
VADGTITLDAGLNLVTIGRGATDKGAINLNWIELDM
Reference
PMID:4826536
  Authors
Sawai T, Toriyama K, Yano K
  Title
A bacterial dextranase releasing only isomaltose from dextrans.
  Journal
J Biochem 75:105-12 (1974)
DOI:10.1093/oxfordjournals.jbchem.a130363
Reference
PMID:8002600
  Authors
Iwai A, Ito H, Mizuno T, Mori H, Matsui H, Honma M, Okada G, Chiba S
  Title
Molecular cloning and expression of an isomalto-dextranase gene from Arthrobacter globiformis T6.
  Journal
J Bacteriol 176:7730-4 (1994)
DOI:10.1128/JB.176.24.7730-7734.1994

DBGET integrated database retrieval system