KEGG   Addendum: BAE92159
Entry
BAE92159          CDS       T10000                                 

Gene name
nahF
Definition
(KEGG) salicylaldehyde dehydrogenase (EC:1.2.1.65)
  KO
K00152  salicylaldehyde dehydrogenase [EC:1.2.1.65]
Taxonomy
TAX:303
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas
Organism
ag  Addendum (Pseudomonas putida)
SSDB
Motif
Pfam: Aldedh DUF1487
Other DBs
NCBI-ProteinID: BAE92159
GB: AB237655
UniProt: Q1XGL7
LinkDB
Structure
PDB: 
4JZ6

AA seq 483 aa
MKTKLFINNAWIDSSDQQTFERKHPVSSEVMTESANATVTDAIKAAQAAEEAFKTWKDVG
PSERRRLLLKVADVMESKTPKFIEVMAMEVGASALWAGFNVHASANVFREAASLATQIQG
ETIPTDKAETLSMTLRQPVGPILSIVPWNGTAVLAARAIAYPLVCGNTVVFKGSEFSPAT
HALITQCVQEAGLPAGVLNYLNSSPDRSPEIADALISAKEIRRINFTGSTRVGSIIAQKA
AQHLKRCLLELGGKSPLIVLDDADINAAVKAAVFGSFLFQGQICMSTERLVVDEKIADEF
VARFVEKTERLSVGDPCLTGDCIIGPMVSPNSGERINGLFKDAIDKGAKVVCGGMAQGAV
MPATILDHVKSDMRIYDEETFGPITVVIRCKGEAEAIRIANDSVYGLSSGVFGRDINRAL
RVGMSIEYGCVHINGSTVQNEAQAPYGGTKNTGYGRFDGRAVIDEFTELKWLTIEPFEQQ
YPF
Reference
  Authors
Sota M, Yano H, Ono A, Miyazaki R, Ishii H, Genka H, Top EM, Tsuda M
  Title
Genomic and functional analysis of the IncP-9 naphthalene-catabolic plasmid NAH7 and its transposon Tn4655 suggests catabolic gene spread by a tyrosine recombinase.
  Journal
J Bacteriol 188:4057-67 (2006)
DOI:10.1128/JB.00185-06

DBGET integrated database retrieval system