KEGG   Addendum: BAM76238Help
Entry
BAM76238          CDS       T10000                                 

Gene name
bphAc
Definition
(KEGG) biphenyl/DDE 2,3-dioxygenase ferredoxin component
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Taxonomy
TAX:946335
  Lineage
Bacteria; Actinobacteria; Micrococcales; Intrasporangiaceae; Janibacter
Organism
ag  Addendum (Janibacter sp. TYM3221)
SSDB OrthologParalogGFIT
Motif
Pfam: Rieske Rieske_2
Motif
Other DBs
NCBI-ProteinID: BAM76238
GB: AB733643
UniProt: F8WQD5
LinkDB All DBs
AA seq 108 aa AA seqDB search
MNLTMACRVDDVAPGAMLRVDVGDEPLLICNVDGEFFATQDTCSHEDWPLSEGYLDGDVV
ECTLHWAKFCVRTGNVKALPACEPLRTYLVKLEGDDVLVDLDSGSGTR
Reference
  Authors
Nguyen PA, Trinh TH, Fukumitsu Y, Shimodaira J, Miyauchi K, Tokuda M, Kasai D, Masai E, Fukuda M
  Title
Gene cluster and regulation system for 1,1-dichloro-2,2-bis(4-chlorophenyl)ethylene (DDE) degradation in Janibacter sp.  TYM3221.
  Journal
J Biosci Bioeng 116:91-100 (2013)
DOI:10.1016/j.jbiosc.2013.01.007

DBGET integrated database retrieval system