KEGG   Addendum: CAA12012
Entry
CAA12012          CDS       T10000                                 

Gene name
snoaE
Definition
(KEGG) bifunctional aromatase (cyclase/dehydratase)
  KO
K15884  bifunctional aromatase (cyclase/dehydratase) [EC:4.2.1.-]
Taxonomy
TAX:38314
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces nogalater)
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc
Other DBs
NCBI-ProteinID: CAA12012
GB: AJ224512
UniProt: Q54490
LinkDB
AA seq 323 aa
MTAGDTTLTTHRTEHRVTVSAPARRVFDLVADITGWPHTFPPTVHAEYAERGASEERIRI
WATANGEVKAWTSHRSLDREGLRVRFRQEKSQHPVAGMGGEWIIRPVDGERSEVILTHDF
QAVEDDPAHVDWIHRAVDRNSGAELAALKPRRNARTARNGTLFTFADEVTVTGAPGDVYD
YLNEARRWQERLPHVAAVSLDEPAPGVQRLGMDTKGPDGTVHTTESVRICFPQDRIVYKQ
FTMPPLMAVHTGTWRIAPAADGHGTTVTSLHTVVVDDSAVTTVLGPDATLADARRFLRDA
LGRNSRTTLGFAKEYAEERARRA
Reference
PMID:8668120
  Authors
Ylihonko K, Tuikkanen J, Jussila S, Cong L, Mantsala P
  Title
A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway.
  Journal
Mol Gen Genet 251:113-20 (1996)
DOI:10.1007/BF02172908

DBGET integrated database retrieval system