Entry |
|
Symbol |
dfrB3, dfr2c
|
Name |
(KEGG) dihydrofolate reductase DfrB3
|
KO |
K19645 | dihydrofolate reductase (trimethoprim resistance protein) [EC:1.5.1.3] |
|
Taxonomy |
|
Lineage |
Bacteria; Pseudomonadota; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella/Raoultella group; Klebsiella |
Organism |
Klebsiella aerogenes
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
AA seq |
78 aa
MDQHNNGVSTLVAGQFALPSHATFGLGDRVRKKSGAAWQGQVVGWYCTKLTPEGYAVESE
SHPGSVQIYPVAALERVA |
Reference |
|
Authors |
Radstrom P, Skold O, Swedberg G, Flensburg J, Roy PH, Sundstrom L |
Title |
Transposon Tn5090 of plasmid R751, which carries an integron, is related to Tn7, Mu, and the retroelements. |
Journal |
|