KEGG   Addendum: CAA57473
Entry
CAA57473          CDS       T10000                                 

Gene name
tylM1
Definition
(KEGG) dTDP-3-amino-3,6-dideoxy-alpha-D-glucopyranose N,N-dimethyltransferase (EC:2.1.1.235)
  KO
K13307  dTDP-3-amino-3,6-dideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.235]
Taxonomy
TAX:1906
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces fradiae)
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_31 Methyltransf_12 Ubie_methyltran NodS MetW CMAS DUF938
Other DBs
NCBI-ProteinID: CAA57473
GB: X81885
UniProt: P95748
LinkDB
Structure
PDB: 

AA seq 255 aa
MAHSSATAGPQADYSGEIAELYDLVHQGKGKDYHREAADLAALVRRHSPKAASLLDVACG
TGMHLRHLADSFGTVEGLELSADMLAIARRRNPDAVLHHGDMRDFSLGRRFSAVTCMFSS
IGHLAGQAELDAALERFAAHVLPDGVVVVEPWWFPENFTPGYVAAGTVEAGGTTVTRVSH
SSREGEATRIEVHYLVAGPDRGITHHEESHRITLFTREQYERAFTAAGLSVEFMPGGPSG
RGLFTGLPGAKGETR
Reference
PMID:9031628
  Authors
Gandecha AR, Large SL, Cundliffe E
  Title
Analysis of four tylosin biosynthetic genes from the tylLM region of the Streptomyces fradiae genome.
  Journal
Gene 184:197-203 (1997)
DOI:10.1016/S0378-1119(96)00595-1
Reference
  Authors
Carney AE, Holden HM
  Title
Molecular architecture of TylM1 from Streptomyces fradiae: an N,N-dimethyltransferase involved in the production of dTDP-D-mycaminose.
  Journal
Biochemistry 50:780-7 (2011)
DOI:10.1021/bi101733y

DBGET integrated database retrieval system