KEGG   Addendum: CAA61987
Entry
CAA61987          CDS       T10000                                 

Gene name
mtmQ
Definition
(KEGG) C7-C12 aromatase (ARO/CYC)
  KO
K15885  C7-C12 aromatase (ARO/CYC) [EC:4.2.1.-]
Taxonomy
TAX:41951
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces argillaceus)
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc AHSA1
Other DBs
NCBI-ProteinID: CAA61987
GB: X89899
UniProt: Q53669
LinkDB
AA seq 315 aa
MPNSQQYSVRDEILVAAPAERVRSLVDDVVGWTQLHGPAVHAHVLRDTGDERLIRHWAVT
GRNSVRTWTARHTRSADASRISFAHVMPEAPFASLEGAWTFRERDGKTRVEMRHDFTLSD
GSAGPADELTARLREGSRAYLSTLGHAAENHEELDRLIISFTDSLFIAGDVKDAYDYLWE
ADKWEERIPHIAKLDLEEPAPGVQFFDMLTSTPDGSSHRTRSVRVTVEPDIIVYKQTELP
ALLDGHTGHWKFTRTPEGVIAEARHTATVKPSALHILGEGTTVQDARNYLRRVLSANSVS
NLRLAKAYAEERAGV
Reference
PMID:8654997
  Authors
Lombo F, Blanco G, Fernandez E, Mendez C, Salas JA
  Title
Characterization of Streptomyces argillaceus genes encoding a polyketide synthase involved in the biosynthesis of the antitumor mithramycin.
  Journal
Gene 172:87-91 (1996)
DOI:10.1016/0378-1119(96)00029-7

DBGET integrated database retrieval system