KEGG   Addendum: CAA79985Help
Entry
CAA79985          CDS       T10000                                 

Gene name
CYP106A2
Definition
(KEGG) steroid 15beta-monooxygenase (EC:1.14.15.8)
  KO
K21114  steroid 15beta-monooxygenase [EC:1.14.15.8]
Taxonomy
TAX:1404
  Lineage
Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus
Organism
ag  Addendum (Bacillus megaterium)
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Integrin_beta
Motif
Other DBs
NCBI-ProteinID: CAA79985
GB: Z21972
UniProt: Q06069
LinkDB All DBs
Structure
PDB: 

AA seq 410 aa AA seqDB search
MKEVIAVKEITRFKTRTEEFSPYAWCKRMLENDPVSYHEGTDTWNVFKYEDVKRVLSDYK
HFSSVRKRTTISVGTDSEEGSVPEKIQITESDPPDHRKRRSLLAAAFTPRSLQNWEPRIQ
EIADELIGQMDGGTEIDIVASLASPLPIIVMADLMGVPSKDRLLFKKWVDTLFLPFDREK
QEEVDKLKQVAAKEYYQYLYPIVVQKRLNPADDIISDLLKSEVDGEMFTDDEVVRTTMLI
LGAGVETTSHLLANSFYSLLYDDKEVYQELHENLDLVPQAVEEMLRFRFNLIKLDRTVKE
DNDLLGVELKEGDSVVVWMSAANMDEEMFEDPFTLNIHRPNNKKHLTFGNGPHFCLGAPL
ARLEAKIALTAFLKKFKHIEAVPSFQLEENLTDSATGQTLTSLPLKASRM
Reference
PMID:8232201
  Authors
Rauschenbach R, Isernhagen M, Noeske-Jungblut C, Boidol W, Siewert G
  Title
Cloning sequencing and expression of the gene for cytochrome P450meg, the steroid-15 beta-monooxygenase from Bacillus megaterium ATCC 13368.
  Journal
Mol Gen Genet 241:170-6 (1993)
DOI:10.1007/BF00280214
Reference
  Authors
Lisurek M, Kang MJ, Hartmann RW, Bernhardt R
  Title
Identification of monohydroxy progesterones produced by CYP106A2 using comparative HPLC and electrospray ionisation collision-induced dissociation mass spectrometry.
  Journal
Biochem Biophys Res Commun 319:677-82 (2004)
DOI:10.1016/j.bbrc.2004.05.037
Reference
  Authors
Lisurek M, Simgen B, Antes I, Bernhardt R
  Title
Theoretical and experimental evaluation of a CYP106A2 low homology model and production of mutants with changed activity and selectivity of hydroxylation.
  Journal
Chembiochem 9:1439-49 (2008)
DOI:10.1002/cbic.200700670

DBGET integrated database retrieval system