KEGG   Addendum: CAC07801
Entry
CAC07801          CDS       T10000                                 

Gene name
cgiA
Definition
(KEGG) iota-carrageenase (EC:3.2.1.157)
  KO
K20850  iota-carrageenase [EC:3.2.1.157]
Taxonomy
TAX:28108
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales; Alteromonadaceae; Alteromonas
Organism
ag  Addendum (Alteromonas macleodii)
SSDB
Motif
Pfam: Pectate_lyase_3
Other DBs
NCBI-ProteinID: CAC07801
GB: AJ272076
UniProt: Q9F5I8
LinkDB
Structure
PDB: 
1H80 1KTW 3LMW

AA seq 491 aa
MRLYFRKLWLTNLFLGGALASSAAIGAVSPKTYKDADFYVAPTQQDVNYDLVDDFGANGN
DTSDDSNALQRAINAISRKPNGGTLLIPNGTYHFLGIQMKSNVHIRVESDVIIKPTWNGD
GKNHRLFEVGVNNIVRNFSFQGLGNGFLVDFKDSRDKNLAVFKLGDVRNYKISNFTIDDN
KTIFASILVDVTERNGRLHWSRNGIIERIKQNNALFGYGLIQTYGADNILFRNLHSEGGI
ALRMETDNLLMKNYKQGGIRNIFADNIRCSKGLAAVMFGPHFMKNGDVQVTNVSSVSCGS
AVRSDSGFVELFSPTDEVHTRQSWKQAVESKLGRGCAQTPYARGNGGTRWAARVTQKDAC
LDKAKLEYGIEPGSFGTVKVFDVTARFGYNADLKQDQLDYFSTSNPMCKRVCLPTKEQWS
KQGQIYIGPSLAAVIDTTPETSKYDYDVKTFNVKRINFPVNSHKTIDTNTESSRVCNYYG
MSECSSSRWER
Reference
  Authors
Barbeyron T, Michel G, Potin P, Henrissat B, Kloareg B
  Title
iota-Carrageenases constitute a novel family of glycoside hydrolases, unrelated to that of kappa-carrageenases.
  Journal
J Biol Chem 275:35499-505 (2000)
DOI:10.1074/jbc.M003404200
Reference
  Authors
Michel G, Helbert W, Kahn R, Dideberg O, Kloareg B
  Title
The structural bases of the processive degradation of iota-carrageenan, a main cell wall polysaccharide of red algae.
  Journal
J Mol Biol 334:421-33 (2003)
DOI:10.1016/j.jmb.2003.09.056

DBGET integrated database retrieval system