KEGG   Addendum: CAC20931Help
Entry
CAC20931          CDS       T10000                                 

Gene name
pimS1
Definition
(KEGG) pimaricinolide synthase PimS1
  KO
K19203  pimaricinolide synthase PimS1
Taxonomy
TAX:68242
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces natalensis)
SSDB OrthologParalogGFIT
Motif
Pfam: ketoacyl-synt KR Acyl_transf_1 Ketoacyl-synt_C PS-DH KAsynt_C_assoc PP-binding adh_short Epimerase Thiolase_N GDP_Man_Dehyd Polysacc_synt_2 PKS_DE Docking RmlD_sub_bind 3Beta_HSD ACP_syn_III NmrA NAD_binding_4 Kelch_4
Motif
Other DBs
NCBI-ProteinID: CAC20931
GB: AJ278573
UniProt: Q9X993
LinkDB All DBs
AA seq 6797 aa AA seqDB search
MSNEEKLREYLKRAIADLHETRQQLDETEAKQREPLAIVSMACRFPGGVRSPEELWELLR
DGVDAVSSFPRNRGWDLDALYHSDPAHQGTSYAREGGFLHDAGEFDPGFFGISPREALAM
DPQQRLLLETAWEAVERAGIDPESLAGSRTGVFVGTGHGGYDAEGRRRADEVGGHLLTGN
HISIASGRISYVLGLEGPALTVDTACSSSLVALHLAMHALRRDECAMALVGGATVMSTPQ
MFVEFSRQRGLAPDGRCKPFAAAADGTGWSEGVGLLLVERLSDAVRNGYPVLAVLKGSAV
NQDGASNGLTAPNGPSQQRVIRQALTGAGLAASDIDAVEAHGTGTTLGDPVEAHALLATY
GQQRAADRPCGLGSMKSNIGHTQAAAGIAGVMKMVLAMRHGHLPRTLHLDEPTGHVDWSE
GNARLLAEPEPWPSAGRPRRAAVSSFGISGTNAHVILEQAPAHEAEPAPEPAARPGALPW
ILSARTEAGLRAQADRLGRHLRDRADLEPAAVAHALADTRTLMEHRAVVVAGDREEFLRG
LDALAAGRTANGLVSGVAVKAASAFLFAGQGSQRPGMGRELHAAHPVFATAFDAVCAELD
PHLDRPLRDIVFAEEGSAEAALLDQTAYTQAALFALETALFRLVESWGVAPRFVAGHSIG
ELTAAHVSGVLTLHDAARLVAARGTLMQALPAGGAMVAVQATEDEIRERLAGHEDHVALA
AANGPDSTVISGDEQAVTEIAAHWEAQGRRTKRLRVSHAFHSPHMDDMLEDFRRVARGLT
FHAPRIPVVSTVTGALATEDELRSPDYWVRQVRETVRFCAAVRTLEAEGVTTFVEIGTGG
VLTPMVQDCLTTLEEPVLVPLLRTGRPETVALTEGVATAFVHGVPVDRSAFPGAPGTSRA
DLPTYAFQRQWYWLDPADHDEGEAAAAEAGEAGFWAAVEREDLQELSAVLAIDGSEADSL
GSFLPTLSSWRRQRRTQAAADRFSYRTHWAPRTASGGPTATGHWLVVLPEGGTDDPWTAR
LLDALNDQGLHTDVRELPADHEPDAWGRHPVDGVLCLLALDERPTRSCPPYRRGLAATTN
AAARPEGAGIQAPLWCVTRGAVAVDRHEALKSPLQAQTWGLGRVAALESPQSWGGLIDLP
DNLDGRAVSALLSTLAGEEDQVAVRPAGVFARRLERITPGGDTGDRWSTHGTVLVTGGTG
ALGAHLAHWLADAGAEHLVLTGRRGPQAPGAPELAAALTDRGVKVTLAACDAADRDALAA
VLADIPPHLPLTGVVHAAGVLDDGVLDALTPERFETVLRPKARAAQNLHELTQDLDLDHF
VLFSSIVGVLGNAGQANYAAANAYLDALAEHRLAQGLPATSVSWGPGQAAAWHDSDAADR
MSRDGLLPMAAAPRRRPAPALAQGMTQVTVADIDWSAYAPALTAVRPSPLIGDLPEARRA
LGPAEGPRRERSPLRDRIGALPPAEQEKAFLTMVREEAARVLGHPSPDTVDAQRAFREQG
FDSLMAVDLRNRLSAATGLRLPATLLFDHPTPLAAAACLRSEVLGAAGPATVVQASTAAL
DEPVAIIGMACRFPGGVHSPEALWRLLAEGGDAITPMPADRGWDLDRLYHPDPDHQGTSY
ARGGGFLDGAADFDADFFGISPREALAMDPQQRLLLETWEVLEQAGIDPESLRGSSTGVF
AGTNTQDYGTALDAAQDEAGGHRLTGNAMSVVSGRVSYTFGFEGPALTVDTACSSSLVAL
HMAAQALRQGECSLAVAGGVTVMATPSSFVEFARQRGLAPDGRCKPFAAAADGTGWSEGV
GLLLVERLSDARRNGHQVLAVVRGSAVNQDGASNGLSAPSGPSQQRVIRQALANARVAAS
EVDAVEAHGTGTTLGDPIEAQALLATYGQERPLLLGAVKSNLGHTQAAAGVAGVMKMVLA
MRHGMLPRTLHVDEPTGHVDWTAGAVELLTEHTDWPETGHPRRAAVSAFGISGTNAHVVL
ELPAAEQPLVEQPSAAEPDAPATAPDRTPTASDGTAPLLLSAKSESALRAQAARLHSHLE
RDPALRLTDAAYTLMTHRTAFAHRAAVRAADHEAALRALTALAAGEADPAVDTGTAHTGR
DAVLFSGQGSQRIGMGRELSGRYPVFAEAFDTVCAALDEHLDRPLRDVVRGEDEELLNRT
VYAQAGLFAIEVALFRLVESWGVRPHYVAGHSVGEIAAAHVAGVFSLADACALVAARGRL
MQALPAGGAMAAIRATEDEVLPHLADSVSIAAVNGPSSVVVSGAEHAVLSIAAHFEGAGR
KTTRLRVSHAFHSPLMDPMLADFRAVAEGLTYGEPELAVVSNVTGQLATPDQLRTPEYWV
THVRAAVRFADGIRALGAEGVTRFLELGPDGVLSALARESAPDDAVCTPVLRKDRSEAAT
LLAALTHLHVHGTEIDWTAFLAGRDAHAVDLPTYAFQHQRFWPTPDHTRTGDLGAVGLEA
TGHPLLSAAVELPDGEGLLFTTRLSLQTHPWLAGHVVMGSVLLPGTAFAELALRAADEVG
CDRVDELTLAAPLVLPEHGGVQLQLRVGPADASGRRTLTARSRAEGDGDRPWVQHATGVL
AEGESTPEPGYDFHTESWPPADAAPVELSGLYPDFAAHGFDYGPHFQGLRTAWRRGDEVF
AEVALPAEAEGEASAYGLHPALLDAALHVVAFNGVDRGVVPFSWESVALHATGASAVRIR
VVRHSGDTVSVDVADTTGEPVASIGTLVLRAVSADQLAGGADPAVRDALFRVQWNPVRLP
PAGAAVTVATLGSLAGAPFDGYPDLASLARSGRVAGAVLVPVEAGAGEVVADDVVGATHA
TAARALDLARSWLADDRFAASRLVFVTRGAVSGADLAGAAVWGLVRSALSEHPGRFGLVD
LDDDAELALVPRVLASDEPQLLVRGGEVLAARLARAQSSHAVTWDPSGTVLVTGGTGGLG
RVMARHLVVEHGVRNLLLVSRRGPAAEGAEELVTELRHSGAEVAVEACDVTDAAAVADLV
ARHRISAVVHTAGVLDDGVVESLTPERLSAVLRPKVDAAWNLHEATRDLDLDAFVVFSSV
AGTIGSPGQANYAAGNAFLDALAHHRRAAGLPAASLAWGPWSRDGGMTGTLTDVDSSASP
GRHARTHPRTGRGLFDAALAAGDAHLLPVRFDWASLRAQGEVPPLLRGLIRTRARRSAVG
GSAAAAGLVGRLSGRGTVERREVLLDLVRAQIAVVLGHANPETIESTRVFQDLGFDSLTA
VELRNRLNNATGLRLSATAVFDYPTADALVDFLLDELFGAQEEAELPAPVPSPAGAADDP
VVIVGMSCRYPGGVGSPEDLWRLVSEGVDAVSDFPTDRGWDVESLYSPDPEALGTSYTRS
GGFLHEAAEFDPDFFGMSPREALATDAQQRLLLETTWEAIERTGIDPASLRGSRTGVFAG
VMYTDYGDLLVGDQFEGYRSNGSAASIASGRVSYTFGFEGPAVTVDTACSSSLVALHWAA
QSLRSGECSLAVAGGVTVMSTPTTFVEFSRQRGLSADGRCKAFADAADGVGWGEGVGMLV
LERLSDARRNGHRVLAVVRGSAVNQDGASNGLTAPNGPAQQRVIRQALASAGLSAADVDA
VEAHGTGTTLGDPIEAQALLATYGQERPEDRPLLLGSVKSNIGHAQAASGVAGVIKMVLA
MRHGVLPRTLHVDEPSSHVDWSAGAVELLTSEAEWPQGEGPRRAGVSSFGVSGTNAHVIL
EQPGPDAADAAPDATVTDPGALAWVLSARNEAALRCQAARLLSLVAGSDALCARDIGHSL
VTGRSSFAHRAVVWGQDRDALVRALSALAVGEADAGLAEGASGAGRTAFLFSGQGSQRLG
MGWELYARYPVFADAFDAVCAALDEHLERPLRDVVWGEDAELLNQTAYAQAGLFAIEVAL
YRLAESWGMRPDFVAGHSIGEVAAAHVSGVFSLPDACALVAARGRLMQQLPSGGAMMAIR
ATEDEVLPHLAEGVSLAAVNGPSSVVISGAEDAVLAIAAHFAGEGRKTTRLRVSHAFHSP
LMEPMLEEFRAVVTRLSFGTPTIPVVSNLTGRLAEPEQLAHADYWVRHVREAVRFADGIQ
ALRAEGVTRFLELGPDGVLSAMARESASDDAVLAPVLRRDRPEETALLGALAQLYVRGAH
VDWTVPFAGSGARWADLPTYAFQHERFWPSGGVARPGDVRSAGLGSAGHPLLGAAVELAG
SGGLLFTGRLSVSSHPWLADHVVLGSVLVPGTALVELVLRAADEAGCDLLEELTLAAPLV
LPASGAAVQVQVAVGEPDEAGRRPVSVHAREGEGPWTLHASGAVTSGAEVPPFDATVWPP
KGAEPVDVADCYDVLADAGLTYGPAFHGLQAAWKLGGDVYAEAKLPESTDGDAYGLHPAL
FDAALHASALGGAEAGGVPFSWAGVSLHATGASHLRVRIREAGGALSVAIADTSGAPVAS
VESLVIRPLSAGQVQAADRDALFKADWVPVPLTDERVEPGTGPEGEPLRTYADLDSLEGA
AVPGTVLVAPPSGAAGTVESVHAATVWALEMVQAWLADDRFATSRLVFVTRGAAFGADLA
AAAVRGLVRSAQSENPGRFGLVDMDGDADTTVPAQALATDEPELLVRGGEVLAARLVRAQ
SSHTVTWDPSGTVLITGGTGGLGRSVARHLVSEHGVRSLLLVSRRGPAAEGAGELVAELR
GSGAEVVIEACDVTDAVAVADLVARHRISAVVHTAGVLDDGVVESLTPERLAVVLRPKVD
AAWNLHEATRGLDLDAFVVFSSVAGTFGSAGQANYAAGNAFLDALAYHRRAVGLPAVSLA
WGPWSQDGGMTGTLSDADVQRIARQGMPPLTVEEGLALFDAALGSAEPMALPVRLDLAAL
RAQGEPQPLLRGLIRTRTRRSGAAAASGIAQRLAGLSTAERREALLDVVRAQIATVLGHA
GPETIAPDRAFQDLGLDSLTAIELRNLLGKATGLRLPATTVFDYPTVDALAAHLLDELFG
AETGTATETPLPVPGLPSLADDPVVIVGMSCRFPGGVASPEDLWRLVADGVDAVSAFPTD
RGWEIDDTYDPEREGAIATRSGGFLHDAAEFDPEFFGMSPREALTTDAQQRLLLETTWEA
LERAGMDPATLRGSRTGVFAGVMYHDYSTLLSGREFEGYQGSGSAGSVASGRVSYTFGFE
GPAVTVDTACSSSLVALHLAAQSLRSGECSLALAGGVTVMSTPLTFVEFSRQGGLSADGR
CKAFADAADGVGWAEGAGILVLERLSDARRNGHRILATVRGSAVNQDGASNGLTAPNGPA
QQRVIRQALASAGLSAADVDAVEAHGTGTTLGDPIEAQALLATYGQERPEDRPLLLGSVK
SNIGHAQAASGVAGVIKMVLAMRHGVLPRTLHVDEPSSHVDWSAGAVELLTSEAEWPQGE
GPRRAGVSSFGISGTNAHVILEQPEPVAAETESITPDTAPDAAEDEAADSGTPVPALLSG
RSASALRAQAARLLSRLDGDPGPRITDVAYSLATGRSAFPHRAVILAANRADLLHSLSAL
AEGHTEAPAVVAQDRARSGKLAFLFSGQGSQRLGMGRELYGRYPAFAEALDAVCAALDAH
LDRPLRDVIWGEDAELLNRTGYAQTGLFAIEVALFRLLESWGVRPDHLLGHSIGEIAAAH
VAGVLSLPDACALVAARGRLMQQLPSGGAMMAIRATEDEVLPHLAEGVSLAAVNGPSSVV
VSGAEDEVLALAAHFEEEGRKTTRLRVSHAFHSPLMEPMLADFRAVADGMTYAAPRIPVV
SNVTGRPATAEELCCAEYWVGHVREAVRFADGVGALREQGVTTFLELGPDGSLSALAAES
AADDSVLAPVLRKNRPEAPALLTALARLHAQGTPVDWSAAFAGTGARWVDLPTYAFQHER
FWPSGGAARAGDVRSAGLGSAGHPLLGAAVELAGSGGRLLTGRLSLSSHPWLADHVVLGS
VLVPGTALMELVLRAADEVDCAAVDELTLAAPLVLPASGAAIQVQVWVGEPDEAGRRPVS
VHAREGEGPWTLHADGALAPAAETVPFDTAIWPPQGAEHLDAAGCYERFADAGFAYGPVF
QGLRAAWKLGEDIYAEVALPEGTDGNAYGLHPALFDAALHAALLGGEGTDEAAVPFSWNG
VTLHATGASRVRVRIRPTEGGTSIALVDTAGAPVASVRSLTARPITAGQLQTGDRDSLFQ
VDWTTLHLTDERANSLALLGKDTEGILDTLSLQPHADLDDLAATGVHDTVLAPLPTRTAG
TVESVHAATTGALALIRSWLADDRFAASRLVFVTRGAVSGTDLAGASVWGLVRSALLEHP
GRFGLVDVDVDQDAEVPLVPRALASDEPQVLVRGGEVLAARLVRAQSSDTVTWDPSGTVL
ITGGTGGLGRSVARHLVSEHGVRSLLLVSRRGPAAEGVDALVAELAECGAQVTVEACDVT
DAVAVADLVARHRISAVVHTAGVLDDGVVESLTPERLSAVLRPKVDAAWNLHEATRGLDL
DAFVVFSSVAGTFGSAGQANYAAGNAFLDALAYHRRAVGLPAVSLAWGPWSQDGGMTGTL
SDADVQRIARQGMPPLTVEEGLALFDAALGSAEPMALPVRLDLAALRAQGEPQPLLRGLI
RTPGRRTAAAATEGDTAAAFAGRLTGLSAAEGREVVLGAVRSQIAGVLGHAEATEIDQDR
AFLDLGFDSLTAVELRNRLGAVTGIRLPATLLFDYPTPAELVAHLHARIAPEPTVGPEAL
LGELERMEKSFGGLDLTEEMHEQIAGRLEVLRAKWDALRDTAAAAGHDGSPSDEDFDFES
ASDDEVFDLLDNELGLS
Reference
  Authors
Aparicio JF, Fouces R, Mendes MV, Olivera N, Martin JF
  Title
A complex multienzyme system encoded by five polyketide synthase genes is involved in the biosynthesis of the 26-membered polyene macrolide pimaricin in Streptomyces natalensis.
  Journal
Chem Biol 7:895-905 (2000)
DOI:10.1016/S1074-5521(00)00038-7

DBGET integrated database retrieval system