KEGG   Addendum: NP_751921
Entry
NP_751921         CDS       T10000                                 

Gene name
E2
Definition
(KEGG) Hepatitis C virus envelope glycoprotein E2
  KO
K22272  HCV envelope glycoprotein E2
Taxonomy
TAX:11103
  Lineage
Viruses; Riboviria; Orthornavirae; Kitrinoviricota; Flasuviricetes; Amarillovirales; Flaviviridae; Hepacivirus
Organism
ag  Addendum (Hepacivirus C)
SSDB
Motif
Pfam: HCV_NS1
Other DBs
NCBI-ProteinID: NP_751921
GB: NC_004102
LinkDB
Structure
PDB: 
5FGB 5FGC 4MWF 4Q0X

AA seq 363 aa
ETHVTGGSAGRTTAGLVGLLTPGAKQNIQLINTNGSWHINSTALNCNESLNTGWLAGLFY
QHKFNSSGCPERLASCRRLTDFAQGWGPISYANGSGLDERPYCWHYPPRPCGIVPAKSVC
GPVYCFTPSPVVVGTTDRSGAPTYSWGANDTDVFVLNNTRPPLGNWFGCTWMNSTGFTKV
CGAPPCVIGGVGNNTLLCPTDCFRKHPEATYSRCGSGPWITPRCMVDYPYRLWHYPCTIN
YTIFKVRMYVGGVEHRLEAACNWTRGERCDLEDRDRSELSPLLLSTTQWQVLPCSFTTLP
ALSTGLIHLHQNIVDVQYLYGVGSSIASWAIKWEYVVLLFLLLADARVCSCLWMMLLISQ
AEA
Comment
Polyprotein 384-746
Reference
PMID:9228008
  Authors
Kolykhalov AA, Agapov EV, Blight KJ, Mihalik K, Feinstone SM, Rice CM
  Title
Transmission of hepatitis C by intrahepatic inoculation with transcribed RNA.
  Journal
Science 277:570-4 (1997)
DOI:10.1126/science.277.5325.570

DBGET integrated database retrieval system