| Entry |
|
|---|
| Gene name |
HBZ
|
|---|
| Definition |
(KEGG) HTLV-1 basic zipper factor
|
|---|
| KO |
| K23071 | HTLV-1 basic zipper factor |
|
|---|
| Taxonomy |
|
|---|
| Lineage |
Viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Ortervirales; Retroviridae; Orthoretrovirinae; Deltaretrovirus |
|---|
| Organism |
ag Addendum (Primate T-lymphotropic virus 1)
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| LinkDB |
|
|---|
| AA seq |
209 aa
MVNFVSAGLFRCLPVSCPEDLLVEELVDGLLSLEEELKDKEEEEAVLDGLLSLEEESRGR
LRRGPPGEKAPPRGETHRDRQRRAEEKRKRKKEREKEEEKQTAEYLKRKEEEKARRRRRA
EKKAADVARRKQEEQERRERKWRQGAEKAKQHSARKEKMQELGIDGYTRQLEGEVESLEA
ERRKLLQEKEDLMGEVNYWQGRLEAMWLQ |
|---|
| Reference |
|
|---|
| Authors |
Seiki M, Hattori S, Hirayama Y, Yoshida M |
|---|
| Title |
Human adult T-cell leukemia virus: complete nucleotide sequence of the provirus genome integrated in leukemia cell DNA. |
|---|
| Journal |
|
|---|
| Reference |
|
|---|
| Authors |
Gaudray G, Gachon F, Basbous J, Biard-Piechaczyk M, Devaux C, Mesnard JM |
|---|
| Title |
The complementary strand of the human T-cell leukemia virus type 1 RNA genome encodes a bZIP transcription factor that down-regulates viral transcription. |
|---|
| Journal |
|
|---|
