KEGG   Addendum: P0C746
Entry
P0C746            CDS       T10000                                 

Gene name
HBZ
Definition
(KEGG) HTLV-1 basic zipper factor
  KO
K23071  HTLV-1 basic zipper factor
Taxonomy
TAX:194440
  Lineage
Viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Ortervirales; Retroviridae; Orthoretrovirinae; Deltaretrovirus
Organism
ag  Addendum (Primate T-lymphotropic virus 1)
SSDB
Motif
Pfam: RR_TM4-6 DUF4569
Other DBs
NCBI-ProteinID: P0C746
GB: J02029
LinkDB
AA seq 209 aa
MVNFVSAGLFRCLPVSCPEDLLVEELVDGLLSLEEELKDKEEEEAVLDGLLSLEEESRGR
LRRGPPGEKAPPRGETHRDRQRRAEEKRKRKKEREKEEEKQTAEYLKRKEEEKARRRRRA
EKKAADVARRKQEEQERRERKWRQGAEKAKQHSARKEKMQELGIDGYTRQLEGEVESLEA
ERRKLLQEKEDLMGEVNYWQGRLEAMWLQ
Reference
PMID:6304725
  Authors
Seiki M, Hattori S, Hirayama Y, Yoshida M
  Title
Human adult T-cell leukemia virus: complete nucleotide sequence of the provirus genome integrated in leukemia cell DNA.
  Journal
Proc Natl Acad Sci U S A 80:3618-22 (1983)
DOI:10.1073/pnas.80.12.3618
Reference
  Authors
Gaudray G, Gachon F, Basbous J, Biard-Piechaczyk M, Devaux C, Mesnard JM
  Title
The complementary strand of the human T-cell leukemia virus type 1 RNA genome encodes a bZIP transcription factor that down-regulates viral transcription.
  Journal
J Virol 76:12813-22 (2002)
DOI:10.1128/JVI.76.24.12813-12822.2002

DBGET integrated database retrieval system