KEGG   Anopheles gambiae (mosquito): AgaP_AGAP000728
Entry
AgaP_AGAP000728   CDS       T01036                                 

Definition
(RefSeq) AGAP000728-PB
  KO
K16679  wengen
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga04013  MAPK signaling pathway - fly
aga04214  Apoptosis - fly
aga04215  Apoptosis - multiple species
aga04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:aga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    AgaP_AGAP000728
   04391 Hippo signaling pathway - fly
    AgaP_AGAP000728
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    AgaP_AGAP000728
   04215 Apoptosis - multiple species
    AgaP_AGAP000728
SSDB
Motif
Pfam: TNFR_c6 CENP-Q
Other DBs
NCBI-GeneID: 1272319
NCBI-ProteinID: XP_311265
VectorBase: AGAP000728
UniProt: Q7PRN3
LinkDB
Position
X
AA seq 304 aa
MRVMRDLPTQHGQMPHGTGGLSQLAGRRRPDGRTTGGRRGRVPTTTLVLLAILLQLMDLG
DGPGGGGGTMLAEAACEPRASWWDPTVDDCVPCRVCADHQVVLRPCQDYMNTVCGTMKDL
TASAHRPYPHLPEGNGNGIVSVGRTRDHHWKEERRKEADGVEGYRRVVPAASTEEILWDW
QVASLLLAIIGCLLFLLAAACVALNQSRQWRRIEKHFDADMEALSAQLVSHLASMQHLES
GPILLENFDHGRLRSTGHHPIEVRCVYLDQLLGKYTSGRSLLGMSVRGDIGRKQTKYSTR
RFLI
NT seq 915 nt   +upstreamnt  +downstreamnt
atgcgggtgatgcgcgatctccccacacagcacggccagatgccgcacgggacgggtgga
ctgtcacagctggcggggcgtcgacgcccggacggacggacgacaggggggcgccggggc
agggtgccgacgacgacgctggtgctgctcgcgatcctgctgcagctgatggatctgggg
gatgggccgggcggcggtggcggcacgatgctggcggaggcggcctgtgagccgcgggcc
agctggtgggacccgaccgtggacgattgcgtcccgtgccgggtctgtgccgaccatcag
gtcgtgctgcgcccgtgccaggactacatgaacacggtgtgcggcacgatgaaggacctg
acggcgtcggctcatcgcccgtacccccatctgcccgaggggaacggtaacgggatcgtg
tcggtcggccgaacccgggatcatcactggaaagaggagcgccggaaagaggcggacgga
gtggagggctaccggcgggtcgtgccggccgccagcaccgaggagatcctgtgggactgg
caggtagcatcgctgctgctcgccatcatcggctgcttgctgttcctgctcgctgccgcc
tgcgtcgccctcaaccagagccgtcagtggcgccgcatcgagaagcactttgacgccgat
atggaagcattatcggcccagctcgtgagccatctggccagcatgcagcatctcgagagt
ggtccgatcctgctggagaactttgatcacggccggctgcgcagtaccggtcaccatccg
atcgaggtccggtgcgtctatctcgaccagctgctcggtaagtacacgtccgggcggtcg
ctgctgggaatgagcgttcgcggcgatattggaaggaagcagactaaatatagcacgcgc
cgcttcctgatctag

DBGET integrated database retrieval system