KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002317Help
Entry
AgaP_AGAP002317   CDS       T01036                                 

Definition
(RefSeq) AGAP002317-PA
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00500  Starch and sucrose metabolism
aga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AgaP_AGAP002317
Enzymes [BR:aga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AgaP_AGAP002317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 1273653
NCBI-ProteinID: XP_312655
VectorBase: AGAP002317
UniProt: Q7PRB7
LinkDB All DBs
Position
2R
AA seq 496 aa AA seqDB search
MRAFVCMLLAAMAVAVSGQFDTHQWGDRSGIVHLFEWKWNDIAAECENFLAPRGYAGVQV
SPPTENAVVWSPRRPWWERYQPISYNLNTRSGSEAEFASMVRRCNAVGVRIYVDLVINHM
AAISTNGGTGGSSANAGAMQFPAVPYGPNDFNPVCTITNYNDPIMVRNCQLVGLPDLNQG
NSWVRDKIVELMNKMINYGVAGFRVDAVKHMWPGDLQAIYSRMANLPTDQGFPPNARPFI
TQEVIDLGGEAISKNEYTHLGTVTEFRFSAEIGKAFYGRNQLRWLANWGPEWGFLPSHLA
LVFVDNHDNQRGHGAGGSDVLTHKVPKNYKMANAFMLAHPFGIPRIMSSFFFNDGDQGPP
SDGDGNLSSPTFNADGSCGGGWACEHRWRQIYNMVGFRNAVAGTSLNDWWDNGGNQIAFC
RGGRGFVAFNLEGYDLNQSLQTCLPAGTYCDVISGSKSGSSCTGASVTVGGDGRANIFIS
ANADDGVLAIHANSRL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgttcgtgtgcatgctgttggcggccatggccgtggcagtgagcggccagttc
gatacgcaccagtggggcgatcggagcggcatcgtgcatctgttcgagtggaagtggaac
gacattgcggcggagtgcgagaacttcctggcgccgcgcggttacgccggcgtgcaggtg
tcgccgccgaccgagaatgcggtcgtgtggagcccgcgccgcccgtggtgggagcgctac
cagccgatctcgtacaacctgaacacccgctcgggcagcgaggccgagttcgcgagcatg
gtgcgccgctgtaacgcggtcggtgtgcgcatctacgtcgatctggtcatcaaccacatg
gcggcgatcagcacgaacggcggtacgggcggttcgtcggccaacgccggcgccatgcag
ttcccggccgtgccgtacggtccgaacgacttcaacccggtgtgcacgatcaccaactac
aacgatccgatcatggtgcgcaactgccagctggtcggactgcccgatctgaaccagggt
aacagctgggtgcgcgacaagatcgtcgagctgatgaacaagatgatcaactacggtgtc
gccgggttccgtgtcgacgcggtcaagcacatgtggcccggcgatctgcaggccatctac
agccgcatggccaacctgccgaccgaccaaggattcccgccgaacgcacgtcccttcatc
acgcaggaggtgatcgatctgggcggcgaagcgatcagcaagaacgagtacacgcacctc
ggcacggtgacggagttccgcttttccgccgagattggcaaggctttctacgggcgcaat
cagctgcgctggctcgcgaactggggccccgagtggggcttcctgccctcgcatctggcc
ctcgtgttcgttgacaaccacgacaaccagcgcggtcacggtgcgggcggttccgatgtg
ctcacgcacaaggtcccgaagaactacaagatggcgaacgcgttcatgctggcccatccg
ttcggtattccgcgcatcatgagctcgttcttcttcaacgatggtgaccagggaccgccg
tccgacggcgacggcaacctgagctcgccgaccttcaacgcggacggctcgtgcggcggt
ggctgggcttgcgagcaccggtggcgccagatctacaacatggttgggttccgcaatgcc
gtcgccggcacctcgctgaacgactggtgggacaacggtggcaaccagattgcgttctgc
cgcggcggccgcggcttcgtcgccttcaacctggagggctacgatctgaaccagagcctg
cagacgtgcctgccggccggcacgtactgcgatgtgatttcgggcagcaagtcgggcagc
agctgcacgggcgctagcgtcaccgttggtggtgacggtcgcgctaacatcttcatctcc
gccaacgcggacgacggtgtgctggccatccacgcgaactcccgactgtaa

DBGET integrated database retrieval system