KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002586Help
Entry
AgaP_AGAP002586   CDS       T01036                                 

Definition
(RefSeq) AGAP002586-PA
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00500  Starch and sucrose metabolism
aga01100  Metabolic pathways
Module
aga_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AgaP_AGAP002586
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aga01003]
    AgaP_AGAP002586
Enzymes [BR:aga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     AgaP_AGAP002586
Glycosyltransferases [BR:aga01003]
 Polysaccharide
  Storage polysaccharide
   AgaP_AGAP002586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Sigma_1s
Motif
Other DBs
NCBI-GeneID: 1273385
NCBI-ProteinID: XP_312352
VectorBase: AGAP002586
UniProt: Q7QCE1
LinkDB All DBs
Position
2R
AA seq 692 aa AA seqDB search
MSRRYSRVESSSDLMQFLDRGHSANTENRWTFEIAWEVANKVGGIYTVIRSKAFVSTEEL
GDQYCLIGPYKEASARTEVEACEFPSNGPFYRAVTAMRNQGFKVHCGRWLVDGNPQIILF
DIGSAAWKMDGYKQELWDSSNVGIPHLDIECNDAIILGYTVATFIDEFKRCAEVYSHENE
YGPPRIVAHFHEWQAGVGLIALRTRQVDVATVFTTHATLLGRYLCAGNTDFYNNLDKFPV
DEEAGKRQIYHRYCLERAATHLSHVFTTVSEITGYEAEHLLKRKPDIITPNGLNVKKFAA
IHEFQNMHAMAKEKIHEFTRGHFYGHFNFNIEKTLYMFIAGRYEFSNKGADIFIEALARL
NHMLKSSNSDVTVVAFLIFPAKTNNFNVESLRGHAVTKQLRDTINSIQQDIGKRMYETCL
QGQLPEGAEILTKEDIVKIKRCLYALQRDGNPPVTTHNVVDDWNDPVLESIRRCHLFNTK
YDRVKVVFHPEFLNSTNPLFGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITT
NLSGFGCFMHEHVADPKSYGIYIVDRRHVAVEESVQQLSKYMFEFSKLNRRQRIIQRNRT
ERLSDLLDWRNLGIYYRQARVKALQRVYPDYVDESTEYLKRATDFTYPRPISAPPSPSSS
RHTTPAPSLHGSDDEQDSVDSEEELQELNSHH
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccgatattcgcgcgtcgagtccagctcggacctgatgcagtttctggaccgt
ggccactcggcaaacacggaaaaccgatggacgttcgagatagcgtgggaggtggccaac
aaagtcggtggcatatacaccgtgatccgatcaaaagcgttcgtgtcgaccgaggagctg
ggcgaccagtactgtctgatcggcccgtacaaggaagcgtccgcccgtaccgaggttgag
gcgtgcgagtttcccagcaatgggccgttctaccgcgcggtcacggccatgcgcaaccag
ggcttcaaggtgcactgtggacgctggctggtcgatggcaatccacagatcatactgttc
gacatcgggtcggcggcgtggaagatggacggctacaaacaggagctctgggactcgtcc
aatgtcggcatcccgcatctggacattgagtgtaacgatgccatcattctcggctacacg
gtggcgaccttcatcgatgagttcaagcgctgcgctgaggtgtactcgcacgagaacgaa
tacggtccgccacggattgtggcccactttcacgagtggcaggcgggcgtcgggctgatt
gcgctccggacgcgccaggtcgatgtggcgaccgtcttcaccacgcacgccaccctgctc
gggcggtacctgtgcgcgggcaacaccgatttctacaacaacctcgacaagttcccggtg
gacgaggaggcgggcaagcggcaaatctaccaccggtactgtttggagcgggcggccacc
cacctgtcgcacgtgtttaccaccgtgtccgagattaccgggtacgaggcggagcatctg
ctgaagcgcaagccggacattatcaccccgaacgggctgaacgtgaagaagttcgcggcg
atccacgagttccagaacatgcacgcgatggcgaaggagaagatacacgagtttacgcgc
ggccacttttacggtcactttaactttaacatcgagaagacgctgtacatgttcattgcc
gggcggtacgagttcagcaacaagggggcggacatctttatcgaggcattggcccgcctc
aaccacatgctgaagtcgagcaactcggacgtgacggtggtggcatttttgatcttcccg
gccaagacgaacaacttcaacgtggagtcgctgcggggccatgccgtcaccaagcagctg
cgcgacacgatcaacagcatccagcaggacatcgggaagcggatgtacgagacgtgcctg
cagggccagctgcccgagggcgcggagatactgacgaaggaggacattgtgaagattaag
cgctgtctgtacgcgctgcagcgcgatggcaatccgcccgtaacgacgcacaacgtggta
gacgattggaacgatccggtgctagagtcgatccgccggtgccatctcttcaacacgaag
tacgatcgcgtgaaggtggtgtttcatccggagttcctgaactctaccaatccgctgttc
gggctggactacgaggagtttgtgcgcggctgccatctcggtgtgttcccgtcgtactac
gaaccgtggggctacacgccggccgagtgtacggtgatgggtataccgagcatcacgacg
aacctgtccgggtttgggtgcttcatgcacgagcacgtggccgatccgaagtcgtacggt
atctacatcgtcgaccggcggcacgttgcggtggaggagagcgtccagcagctgtccaag
tatatgttcgagttttcgaagctcaaccgccgccagcgcatcattcagcgtaatcgaacg
gagcggttgagcgatctgcttgactggagaaatctgggaatttactaccgccaggcgagg
gttaaggcactgcagcgtgtgtatccggattatgtggacgagtctacggaatacctgaag
cgagcgacagacttcacatatccacgcccgatcagtgccccaccaagtcctagttcgtcc
agacatacaacgccggcaccgtccctgcacggttcagacgatgaacaggattccgtcgac
tctgaggaggaactacaggagctaaactcacaccattag

DBGET integrated database retrieval system