KEGG   Anopheles gambiae (mosquito): AgaP_AGAP003581Help
Entry
AgaP_AGAP003581   CDS       T01036                                 

Definition
(RefSeq) AGAP003581-PA
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00040  Pentose and glucuronate interconversions
aga00051  Fructose and mannose metabolism
aga01100  Metabolic pathways
Module
aga_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AgaP_AGAP003581
   00051 Fructose and mannose metabolism
    AgaP_AGAP003581
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     AgaP_AGAP003581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 Pyr_redox_3 YdfZ HI0933_like AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 1274246
NCBI-ProteinID: XP_313335
VectorBase: AGAP003581
UniProt: Q7QAQ6
LinkDB All DBs
Position
2R
AA seq 363 aa AA seqDB search
MAPNKNLAATVYGPNDLRLDERPIPEPAFNEVVVEVDTCGICGTDIHFLKDGGFGAQRLV
KPIVLGHESAGVVRKVGSAVTHLKVGDRVAIEPAAGCRTCDLCKVGKYNICLDGKHCTTQ
KHDGNCSNYYAQYADCCFKLPDHVTMEEGALLEPLAVAVYAGRRADIRLGQRVIIFGAGP
IGLVCLIAAKAMGATRTVILDLEHAKHRLEVAKKLGVTGVIGIRKEDTEEDLVKRIHEIL
GGPADRVLECSGSQPGMRVAIKATRNAGRICLVGLGNKDAQLPMVDAISREIEITTAMRY
NHDYPAALEIVASGYVDVKPLVSHHFDLQDVHEAFRVASQGEGIKIMIHLVPRDTNNHGK
FTN
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgaacaaaaatcttgccgcaaccgtgtacggtcccaacgatctgcggctggac
gagcgtcccataccggagccggcattcaacgaggtcgtggtggaggttgatacctgtggc
atctgtggtacggacatccacttcctgaaggatggtggtttcggtgcccagcggctcgtc
aaaccgatcgtgctcggtcacgagtcggccggtgtagtgcgcaaggtgggcagtgccgtg
acgcacctgaaggtaggcgatcgggtcgcgatcgagccggcggctggctgccgtacgtgc
gatctgtgcaaggtgggcaagtacaacatctgtctggatgggaagcattgtacgacgcag
aagcacgatggcaactgctcgaactactatgcgcaatacgcggactgctgcttcaagctg
ccggatcacgtcacgatggaggagggcgcactgcttgaaccgctggccgttgccgtgtat
gcgggtcggcgggcggacattcggctagggcagcgcgtgatcatcttcggtgccggaccg
atcgggctggtgtgcttgatcgctgccaaggcgatgggtgcgacgcgcacggtcatactg
gatctggagcatgccaagcatcggttagaggtcgccaagaagcttggtgtgacgggcgtg
atcggtatccggaaggaggacaccgaggaggacctggtgaagcggatacacgagatcttg
ggcgggccggccgatcgggtgctcgagtgttccggctcgcagcccggcatgcgggtggcg
atcaaggcgaccagaaacgcgggccgcatctgtttggtggggctaggcaataaggacgct
cagctgccgatggtggatgcaatctcgcgggaaatcgaaatcaccactgcgatgcgttac
aatcatgactatcctgccgcattggaaatcgtagccagtgggtacgttgacgtgaagccg
ctagtttcgcaccacttcgatctgcaggacgtgcacgaggctttccgggtggcatcgcag
ggcgaaggtattaagattatgattcaccttgtgccacgggacaccaacaaccatggcaaa
tttacgaactaa

DBGET integrated database retrieval system