KEGG   Anopheles gambiae (mosquito): AgaP_AGAP005749Help
Entry
AgaP_AGAP005749   CDS       T01036                                 

Gene name
GSTO1
Definition
(RefSeq) AGAP005749-PA
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00480  Glutathione metabolism
aga00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AgaP_AGAP005749 (GSTO1)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AgaP_AGAP005749 (GSTO1)
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     AgaP_AGAP005749 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C Glutaredoxin GST_C_3
Motif
Other DBs
NCBI-GeneID: 1276420
NCBI-ProteinID: XP_315763
VectorBase: AGAP005749
UniProt: Q86D85
LinkDB All DBs
Position
2L
AA seq 248 aa AA seqDB search
MSNGKHLAKGSSPPSLPDDGKLRLYSMRFCPYAQRVHLMLDAKKIPYHAIYINLSEKPEW
YLEKNPLGKVPALEIPGKEGVTLYESLVLSDYIEEAYSAQQRKLYPADPFSKAQDRILIE
RFAGSVIGPYYRILFAADGIPPGAITEFGAGLDIFEKELKARGTPYFGGDKPGMIDYMIW
PWCERVDLLKFALGDKYELDKERFGKLLQWRELMEKDDAVKQSFISTEDHTKFLQSRKNG
ENNYDILA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacggaaagcatctcgccaaaggttccagcccaccatccctcccggacgatggt
aagctgcgcctgtactcgatgcgcttctgcccgtacgcccagcgcgtccacctgatgctg
gacgcgaagaagatcccgtaccacgcgatctacatcaacctgtccgagaagccggaatgg
tacctggagaagaacccgctcggcaaggtgccggcactggagattcccggcaaggagggc
gtcaccctgtacgagtcgctcgtcctgtccgactacatcgaggaggcgtactcggcccag
cagcgcaagctgtacccggccgacccgttcagcaaggcgcaggatcgcatcctgatcgag
cggttcgccggctcggtcattgggccgtactatcgcatcctgttcgcggccgacggcatc
ccgcccggtgccatcaccgagttcggcgcggggctggacattttcgagaaggagctgaag
gcgcggggcaccccgtacttcgggggcgataagccgggcatgatcgactacatgatctgg
ccgtggtgcgagcgggtcgatctgctcaagtttgcgctcggcgataagtacgagctggac
aaggagcggttcggtaaactgctgcagtggcgagagctgatggaaaaggacgacgccgta
aagcagtcgttcatttcgaccgaggaccacacgaagttcctgcagagccgcaagaacggc
gaaaacaactacgatatcttggcgtaa

DBGET integrated database retrieval system