KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008296Help
Entry
AgaP_AGAP008296   CDS       T01036                                 

Gene name
TRY1_ANOGA
Definition
(RefSeq) AGAP008296-PA
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    AgaP_AGAP008296 (TRY1_ANOGA)
Enzymes [BR:aga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     AgaP_AGAP008296 (TRY1_ANOGA)
Peptidases [BR:aga01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   AgaP_AGAP008296 (TRY1_ANOGA)
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AgaP_AGAP008296 (TRY1_ANOGA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 Peptidase_S55
Motif
Other DBs
NCBI-GeneID: 1277688
NCBI-ProteinID: XP_317170
VectorBase: AGAP008296
UniProt: P35035
LinkDB All DBs
Position
3R
AA seq 274 aa AA seqDB search
MSNKIAILLAVLVAVVACAEAQANQRHRLVRPSPSFSPRPRYAVGQRIVGGFEIDVSDAP
YQVSLQYNKRHNCGGSVLSSKWVLTAAHCTAGASPSSLTVRLGTSRHASGGTVVRVARVV
QHPKYDSSSIDFDYSLLELEDELTFSDSVQPVGLPKQDETVKDGTMTTVSGWGNTQSAAE
SNAVLRAANVPTVNQKECNKAYSEFGGVTDRMLCAGYQQGGKDACQGDSGGPLVADGKLV
GVVSWGYGCAQAGYPGVYSRVAVVRDWVRENSGV
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacaagattgcaatcctcctggctgtgctggttgcggtagttgcctgcgcggag
gcgcaggccaaccagcgccatcggcttgtaagaccgagcccgagtttctccccgcgaccc
cggtacgccgttggccaacgcatcgtcggtgggttcgagatcgacgtgtcggatgcaccg
tatcaggtgtcgctccagtacaacaagcgccacaactgcggtggttccgtcctgtccagc
aagtgggtgcttacggccgctcactgcacagccggtgcttcgccctccagcttgaccgtg
cgcctgggaacatcgcgtcacgcttcgggaggaaccgtggttcgtgttgctcgcgtcgtg
cagcatcccaaatacgatagcagcagcatcgatttcgactactccctgctggagctggaa
gacgaacttaccttcagcgattcagtgcagccggttggtctgccgaaacaggacgaaacg
gtgaaggatggaaccatgacgactgtgtctggctggggcaacacccagagtgccgccgaa
tcgaatgccgttctgcgggctgccaacgtaccgaccgttaaccagaaggagtgcaacaaa
gcttatagtgagttcggaggtgttaccgatcgtatgctgtgcgccggataccagcagggc
ggaaaggacgcttgccagggagactctggtggtccgctggttgctgatggcaagctggtt
ggtgtggtttcgtggggctacggttgcgctcaggccggttatccgggagtgtattcgcgg
gttgcagtcgtccgcgactgggtgcgcgagaacagtggagtttaa

DBGET integrated database retrieval system