KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009222Help
Entry
AgaP_AGAP009222   CDS       T01036                                 

Definition
(RefSeq) AGAP009222-PA
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga03030  DNA replication
aga03410  Base excision repair
aga03420  Nucleotide excision repair
aga03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:aga00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AgaP_AGAP009222
   03410 Base excision repair
    AgaP_AGAP009222
   03420 Nucleotide excision repair
    AgaP_AGAP009222
   03430 Mismatch repair
    AgaP_AGAP009222
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aga03032]
    AgaP_AGAP009222
   03400 DNA repair and recombination proteins [BR:aga03400]
    AgaP_AGAP009222
Enzymes [BR:aga01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AgaP_AGAP009222
    6.5.1.6  DNA ligase (ATP or NAD+)
     AgaP_AGAP009222
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     AgaP_AGAP009222
DNA replication proteins [BR:aga03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    AgaP_AGAP009222
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     AgaP_AGAP009222
DNA repair and recombination proteins [BR:aga03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AgaP_AGAP009222
   NER (nucleotide excision repair)
    Other NER factors
     AgaP_AGAP009222
   MMR (mismatch excision repair)
    Other MMR factors
     AgaP_AGAP009222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 1280180
NCBI-ProteinID: XP_319999
VectorBase: AGAP009222
UniProt: Q7PVP5
LinkDB All DBs
Position
3R
AA seq 752 aa AA seqDB search
TKTKTSPKKEPAIGKEKKEAKKTSPKTTKKSSPKAATTVKKEENPSPTKEKKPSEEKKPD
APAKPTNGAARSFFFSVKKQPDESEGAAGGAASSGNDGSKYDPSKKNYHPLKDAFWKQGD
RVPYLALARTFQMIEETSGRLRMIEILSNYFRSVILLSPRDLLASVYLCLNQLAPAYEGV
ELGIAEFSLMKAIAQSTGRSLAQIKADAQTTGDLGLVAEQSKSSQHLMFRPAPLSVEVVF
GKLREIASMTGSASMAKKMDKIQSMFVACRHSESRYIIRSLAGKLRIGVAEQSLLQALAQ
ACALTPPHADPPVVNALAGESEARVKARVDEVALALKTVYCQCPNYNRIVPVLLEHGVQR
LSEHCPMEPGTPLKPMLAHPTKGVQEVLQRFDGIDFTCEWKYDGERAQIHLLADGSVQIF
SRNQENNTSKYPDVIARLEFTRTEPVASAILDCEAVAWDTDKRQILPFQVLSTRKRKDAN
EADIKVQVCVFMFDLLYLNGEPLVERPFVERRELLYRHFREIEGQWQYATRLDTGDLDEL
QRFLDEAVRGNCEGLMVKTLAREATYEIAKRSRNWLKLKKDYLTGVGDSLDLVVIGGYRG
RGKRTGTYGGFLLACYDEENEEYQTICKIGTGFSDDDLQRHTEFFRSHVIAAAKPYYRHE
ANVVPDDWFEPVQVWEVLCADLSLSPVHRAGIGIIDPEKGISLRFPRFIRVREDKGVTDA
TSARQVSEMYLNQDQIKNQTGSNARDVEEDFY
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
acaaaaacgaaaacaagcccgaaaaaagaacccgctatcgggaaggagaaaaaagaggca
aagaaaacatcacccaaaacgacgaaaaaatcctccccaaaagcagccaccaccgtaaag
aaggaggaaaatccatcaccgacgaaggagaagaagccatcggaagagaagaaaccggac
gctcctgccaagccgaccaacggtgcggcgcgttcctttttcttctccgtcaaaaagcag
ccggatgagtcggaaggtgcggccggtggggcggcatcgtccggcaacgatgggtccaag
tacgatccgtcgaagaaaaactatcacccactaaaggacgcattttggaagcagggtgac
cgcgtaccgtacctggcgctcgcgcgcaccttccaaatgatcgaggaaacgagcggccgg
ctgcggatgatcgagatcctctcgaactacttccgctcggtgatactgctcagcccgcgc
gacctgctcgccagcgtgtacctctgcctgaaccagctcgcaccggcctacgagggcgtg
gagcttggcattgccgagttttcgctcatgaaagcgatcgcgcaaagcaccggccgcagt
ctggcgcagatcaaggcggacgcacaaacgaccggcgatctcggcctggtggcggagcag
tccaaaagcagccagcatctaatgttccgaccggcgccgctctcggtcgaggtggtgttt
ggcaagctgcgcgaaatcgcctccatgaccgggtccgcctcgatggcgaaaaagatggac
aaaatccagtcgatgttcgtggcctgccgccactcggagtcacgctacatcatccgttcg
ctcgccggcaagctgcggatcggcgtcgcggaacaatcgctcctgcaggcgctcgcccag
gcctgtgcccttacgccgccccatgccgacccgcctgtagtgaacgcactggcgggcgag
tcggaagcgcgcgtgaaggcccgcgtcgacgaggtggcgctggcgctgaaaaccgtctac
tgccagtgcccgaactacaatcgcatcgtgccggtgctgctagagcacggcgtgcagcgg
ctgagcgagcactgccctatggagccgggcacgccgctcaagccgatgctggcccacccg
accaagggcgtgcaggaggtgctgcagaggttcgatgggatcgatttcacgtgcgagtgg
aagtacgacggcgagcgcgcccagatccatctgctggccgacggcagtgtgcagatcttt
agccgcaaccaggagaacaacacgagcaagtatccggacgtgattgcgcggctagagttt
acgcgcaccgagccggtcgcgagcgccatcctcgactgcgaggcggtcgcgtgggacacg
gacaagcggcagatactaccgttccaggtgctgagcacccggaagcggaaggacgcgaac
gaggccgacatcaaggtgcaggtgtgcgtgttcatgttcgatctgctgtacctgaacggg
gagccgctggtcgagcgaccgttcgtcgagcggcgcgagctgctgtaccggcacttccgc
gagatcgagggccagtggcagtacgcgacccggctcgatacgggcgatctggacgagttg
cagcgctttctggacgaggcggtgcgcggcaactgcgagggcctgatggtgaaaacgctg
gcccgcgaggcgacgtacgagatagcgaagcggtcgcgcaactggctcaagctcaagaag
gactacctgaccggggtgggcgattcgctcgatctggtcgtgatcgggggctaccggggc
cggggcaagcggaccggcacgtacgggggcttcctgctcgcctgctacgacgaggagaac
gaggagtaccagacgatctgcaagatcgggaccggcttctccgacgacgatctgcagcgc
cacacggagtttttccgatcgcacgtgatagcggccgcgaaaccgtactaccggcatgag
gcgaacgtcgtgcccgacgattggttcgagccggtgcaggtgtgggaggtgctgtgtgcc
gatctgtcgctcagcccggtgcaccgggccggcatcggcatcatcgatccggagaagggc
atttcgctgcgctttccgcgcttcatacgggtgcgcgaggacaagggcgtgacggacgca
acgagcgcccggcaggtgtcggagatgtatctgaaccaggatcaaattaagaaccagacc
ggaagcaatgctcgcgacgtggaggaagatttttactga

DBGET integrated database retrieval system