KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009628Help
Entry
AgaP_AGAP009628   CDS       T01036                                 

Definition
(RefSeq) AGAP009628-PA
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00562  Inositol phosphate metabolism
aga01100  Metabolic pathways
aga04068  FoxO signaling pathway
aga04070  Phosphatidylinositol signaling system
aga04140  Autophagy - animal
aga04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AgaP_AGAP009628
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    AgaP_AGAP009628
   04070 Phosphatidylinositol signaling system
    AgaP_AGAP009628
   04150 mTOR signaling pathway
    AgaP_AGAP009628
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    AgaP_AGAP009628
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aga01009]
    AgaP_AGAP009628
Enzymes [BR:aga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AgaP_AGAP009628
    3.1.3.48  protein-tyrosine-phosphatase
     AgaP_AGAP009628
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     AgaP_AGAP009628
Protein phosphatases and associated proteins [BR:aga01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    AgaP_AGAP009628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 DSPn Y_phosphatase2 CDKN3
Motif
Other DBs
NCBI-GeneID: 3292014
NCBI-ProteinID: XP_553421
VectorBase: AGAP009628
UniProt: Q5TPC4
LinkDB All DBs
Position
3R
AA seq 324 aa AA seqDB search
IRDMANPTNFIREKVSGQRFRYTDDEFNLDLTYITPKIIAMGFPAGNVEAIYRNNREHVV
KLLTQRHDKKFKVYNLCSERTYDPKLFPYHAEYPFKDHNPPDIELIDKFCKDVDSFLNAD
SSHVVAIHCKAGKGRTGTMICCYLLYNNSFQTAHEALTYYAEKRTKDKKGVTIPSQRRYV
VYYEQLLRQNLTYRKVSLYVSSVPRSFQSPILELRIFPADLPLKVGSIQQKDMKEPLPLV
KFRRTDHYISVELDCCMPLAGDVKVEFRPNKLDKGWHFWFNTFFVELAGADQSQGRFVLT
LDKQEIDDAHKGSAKKCPEQVCSV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atccgggacatggctaacccgacgaacttcatccgggagaaggttagtgggcagcggttc
cgctacaccgacgatgagttcaatctggaccttacgtatattacgccaaagatcatcgcc
atgggctttccggcgggcaacgtggaggccatctaccggaataatcgcgaacacgtggtc
aagctactcacccagcggcacgacaaaaagttcaaagtgtacaacctttgctcggagcgt
acgtacgatccgaaattgtttccgtaccatgccgaatatccgttcaaggatcataacccg
ccggatatcgaactgatcgacaagttctgcaaagatgtggacagcttcctgaatgcggat
agttcgcatgtcgtggcgatccactgcaaggctggcaaaggacgcacgggaacaatgatc
tgctgctacttgctgtacaacaacagcttccagacagcccacgaggcactgacgtattat
gcggaaaagcgcacgaaggataagaaaggggtcaccattccttcgcagcgccgctacgtg
gtgtactacgagcagctgttgcgccaaaacctaacgtaccggaaggtgtcgctctatgta
agctctgttccgagaagcttccaatcgcctattcttgagctgcgcatctttcccgccgat
ttgccgttgaaggtaggctcgatccagcagaaggacatgaaggaaccgctgccgctggtg
aagttccggcgcacggaccactacatatcggtcgagctcgactgctgtatgccactggcc
ggcgacgtgaaggtcgagtttcgaccgaacaaactcgacaaagggtggcacttttggttt
aatacgtttttcgtcgagctagctggtgccgaccaatcacagggccgattcgtcctgaca
ctggacaaacaagagattgacgacgcgcacaaaggtagcgccaaaaagtgccccgaacag
gtatgtagcgtttag

DBGET integrated database retrieval system