KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009757Help
Entry
AgaP_AGAP009757   CDS       T01036                                 

Gene name
ANCE7
Definition
(RefSeq) AGAP009757-PA
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
aga  Anopheles gambiae (mosquito)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aga01002]
    AgaP_AGAP009757 (ANCE7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aga04147]
    AgaP_AGAP009757 (ANCE7)
   04090 CD molecules [BR:aga04090]
    AgaP_AGAP009757 (ANCE7)
Enzymes [BR:aga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     AgaP_AGAP009757 (ANCE7)
Peptidases [BR:aga01002]
 Metallo Peptidases
  Family M2
   AgaP_AGAP009757 (ANCE7)
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AgaP_AGAP009757 (ANCE7)
CD molecules [BR:aga04090]
 Proteins
  AgaP_AGAP009757 (ANCE7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 1279163
NCBI-ProteinID: XP_318843
VectorBase: AGAP009757
UniProt: Q7Q1J9
LinkDB All DBs
Position
3R
AA seq 922 aa AA seqDB search
MLKLLIKCTIGALFALQSIHCEADPQLNLPPLAPPGLEGRRPVTFPNGEASPTRVPLGVD
GVVSGDGSSVHDRSRSERFGPPYDGDDDEEDERPNYPAQQPEGRANDYDRRDRQDSPYSY
NDRNRYGGDRGYDRNQNRERYPGDRSPNPYVSDVDNPLLYRDGGDRNRNRYVSDVENPLL
YRDRTPYNPSRDYDDRNRYNPNARPYNPNDPSFGGRNPPDPNYRGPGQRDPNYRDQGFRE
PGQRFPGDDRTRYPDDPNYPYRSPEEERFRIENERRFRAETEKLRAFLTEIDRKSSLECS
LNVAAQWNFETNINDATQVEALAAQQRYNDFQRLLWDQMRRIDQTKIFDDKLYRQVRLMS
IIGPSALPPDQLDRYNRIVNDMLAIFNGATICAYEQPFECGLRLQPHLKDVSEQSIMAKS
RDWNELQYTWLEWRRKSGRNMRDLFEQLVDLTNDAGRVNNFTDAAAYWTFPYESRNFREE
MEQVWREILPLYEMIHAYVRRKLREFYGPDKINKNAPLPDHILGDMYGQSWQNILDIVIP
YPGRSFLEVTPEMQKQGYNPLVMFQIAEEFFVSMNMSAMPPDFWASSIVTQPPDRPILCQ
PSSWDFCTGKDYRVKMCTQVTHKDFITVHHELAHIQYFLNYRNNPKVFRDGANPGFHEAI
GDAISLSVASPKHLQNLGLVQKSVDDTAHDINFLFSLAMEKVVFLPFALALEAWRYDVFS
KRVRKEQYNCHWWLLREEYGGVKPPVLRSELDFDPGAKYHVAANIPYIKYFFSNVLQFQI
YRALCTASGQYVPQDPSKPLHKCDIYRQPAAGNILKKLMERGTSQPWQQVLQEVIGEGRL
DGSALREFFRPLEEWLRNENLRNNEYVGWIYDGDYCKHSIETANLQVFGGFYNVAVEVQL
TSWLMLMLSSWLVVMRTFAIVG
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagctgctgataaagtgcaccatcggtgcgttatttgccctacaatcgatccat
tgtgaggctgatccacagcttaaccttccacctttggcaccgccgggtctggaagggcgt
cggcccgtgacatttcccaacggggaagcatcgccgacgcgtgtaccgctcggtgtggat
ggtgtcgtcagtggggatggtagcagtgtgcacgatcggagtagaagtgagcgctttggt
ccaccgtacgatggggatgacgatgaagaagacgaacgtccgaactatcccgcccagcaa
ccggaagggcgcgcgaatgattacgataggcgagatcgtcaggattcgccttactcctac
aacgatcgcaacaggtacggtggggatcgtggctacgatcgcaatcaaaaccgtgaacga
tatccaggcgatcgtagtccaaatccgtacgtttctgatgtagacaatccattgctgtat
cgggatggaggcgatcgcaatcggaacaggtacgtgtccgatgtggagaatccactgctt
taccgcgatcggacaccgtacaatccgagccgggactatgacgatcgtaaccggtacaat
cccaacgcaagaccgtataatccaaacgatcctagctttggaggacgcaatccacccgat
ccaaactatcgcgggccagggcagcgtgatccaaactaccgtgatcaagggttccgagag
cctggtcaacggtttccgggcgatgatcgtacccggtatccggacgatcctaactatccg
taccgcagcccggaagaggaacgattccgcatcgagaacgagcggcggtttcgggcggaa
acagaaaagctacgagcgtttctcacggagatcgatcggaaaagctcactggagtgttcg
ttgaatgtggcggcgcagtggaactttgagacaaacatcaacgatgcaacgcaggtggaa
gcgcttgctgctcagcaacggtacaacgacttccagcgcctgctgtgggatcaaatgcgc
cgaatagaccagacgaaaatcttcgacgacaagctgtaccgccaggtgcgtcttatgtca
atcattggtccaagtgcgctgcccccggatcagctcgatcggtacaatagaatcgtgaac
gatatgctggccatctttaacggtgccaccatctgcgcgtacgagcaaccgttcgagtgt
ggactacgccttcaaccccatctgaaagatgtgagtgaacaaagcataatggcaaagagt
cgcgattggaatgagctgcagtacacttggctcgagtggcgtcgaaaatcgggccgcaac
atgcgagatctcttcgagcagttggtcgaccttacgaacgatgctgggcgtgttaataac
tttactgatgccgccgcctactggacgttcccgtatgagtcacgcaattttcgcgaggaa
atggaacaggtgtggcgcgagatacttccgctgtacgagatgattcatgcgtacgtgcgc
cgcaagctgcgcgaattctacggtccggataagatcaacaaaaatgcaccccttccggac
cacatactgggtgacatgtacgggcagagctggcagaacatcctggacattgtgataccg
tacccgggccgtagctttctcgaggtaacgccagaaatgcaaaagcagggctacaatccg
ctggttatgttccagatcgcggaagagttcttcgtgtcgatgaatatgtccgcaatgcca
ccggacttttgggcgtcatccatcgtgacgcaaccgccagacagaccgatcctgtgccaa
ccgtcttcgtgggacttttgcaccggaaaggactaccgcgtcaagatgtgtacgcaggtg
acgcacaaagatttcattaccgtgcaccacgagctggcgcacatacagtactttctcaac
tatcgtaacaatccgaaggtgttccgcgatggagctaatccaggtttccatgaagcgatc
ggtgatgcaatctcgctctctgtcgcctcgccgaagcatttgcaaaatctgggcctcgtc
cagaagtccgtcgatgatacggcgcacgacataaacttcctgttttcgctcgcgatggaa
aaggtagtgtttttaccgtttgcgctcgcccttgaagcgtggcggtatgacgtcttcagc
aagcgcgtccgcaaggagcagtacaactgccactggtggctgctgagggaggaatatggc
ggggttaaaccaccggtgctccggtccgaacttgactttgaccctggtgcaaagtatcac
gtggcagcaaacatcccgtacatcaaatactttttttccaacgtgctacagtttcagatc
tatcgcgccctgtgcaccgcctcgggtcagtacgtaccgcaggatcccagcaaaccgttg
cataagtgtgacatctaccgccaaccggcagccggtaacattctcaaaaagctgatggaa
cgcggaacgtcacaaccgtggcagcaggtcctgcaggaggtgatcggcgagggccggctg
gacgggtcggcattgcgtgagtttttccgaccgctcgaggaatggctgaggaatgagaac
ctgcgcaacaacgagtacgtcggctggatctacgatggtgactactgcaagcacagcatc
gagacggccaatctgcaagtgttcggtggcttctacaatgttgcagtcgaggtgcagctt
accagctggctgatgctgatgctgagctcctggttagtcgtgatgcgaacgttcgccatc
gtcggctaa

DBGET integrated database retrieval system