KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010429Help
Entry
AgaP_AGAP010429   CDS       T01036                                 

Definition
(RefSeq) AGAP010429-PA
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00020  Citrate cycle (TCA cycle)
aga00190  Oxidative phosphorylation
aga01100  Metabolic pathways
aga01200  Carbon metabolism
Module
aga_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aga_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aga_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AgaP_AGAP010429
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AgaP_AGAP010429
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AgaP_AGAP010429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 1272618
NCBI-ProteinID: XP_311518
VectorBase: AGAP010429
UniProt: Q7QDV0
LinkDB All DBs
Position
3L
AA seq 659 aa AA seqDB search
MSGMIRLPTVLAKNALSAVRGLTAGTSQRNLHFTVGQNNAKSNPDAISREYPVVDHTYDA
VVVGAGGAGLRAAFGLVAEGFKTAVITKLFPTRSHTVAAQGGINAALGNMEEDDWKWHMY
DTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTPDGKIYQRAFGGQSLKYGKGG
QAHRCCCVADRTGHSLLHTLYGQSLSYDCNYFIEYFAMDLLMQNGECVGVIAMNLEDGSI
HRFRAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVARAGLPSEDLEFVQFHPTGIYGAG
CLITEGCRGEGGYLINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPEKDHV
YLQLHHLPPEQLAQRLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYKGQVLTT
QNGADRVVPGLYACGEAACSSVHGANRLGANSLLDLVVFGRACAKTIAEENRPGEKVQDL
KPNAGEASVANLDWVRNADGQVPTSTLRLNMQKTMQTHAAVFREEKTLQEGVRKMGDIYK
TIKDVKVSDRSLVWNSDLVETLELQNLLLNANMTIVAAENRKESRGAHAREDYKQRVDEY
DFSKPLEGQQKKPVEEHWRKHTLTWIDPATGNVTIDYRPVIDETLSEECATVPPAIRSY
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaatgattcgacttccaacggtgcttgccaagaacgcgctttcagcggttcga
ggcttgactgctggtacgtcacagcgcaacctgcatttcaccgttggacagaataatgca
aaatcgaacccggatgccatttcgcgagagtatcccgtcgttgaccatacctacgatgcg
gtcgttgttggggccggcggtgcaggactgcgtgccgcttttgggctggttgcggaagga
ttcaagactgccgttattacgaagctgttccctacccgttcccacaccgtcgccgcacag
ggtggcatcaatgccgcactgggtaacatggaggaggacgactggaagtggcacatgtac
gatacggtgaagggatccgactggttgggagaccaggatgccatccactacatgacgcgc
gaggcgccgaaagcggtcattgagctggaaaactatggtatgccgttctcccgcacgccc
gatggcaagatttaccagcgtgccttcggaggacagagcttgaagtacggtaagggtgga
caggcgcatcgctgctgttgcgttgcggatcgtaccggccactcgctgctgcacacgctg
tacggccagtcgctcagctacgactgcaactacttcatcgaatactttgccatggacttg
ttgatgcagaacggcgagtgtgtcggtgtgattgcgatgaacctggaggatggtagcatt
catcgcttccgtgcgaagaacacggtgctggctactggtgggtacggtcgtgcgtacttc
tcctgcacctcggcgcatacctgcaccggcgacggtacggcaatggtggcgcgcgctgga
ctgccctcggaagatttggagtttgtgcagttccacccgacgggcatctacggtgccggt
tgcctgatcacggagggctgccgcggtgagggtggctatttgatcaactcgcagggtgaa
cggttcatggagcgctacgcgccggtggcgaaggatttggcctcgcgtgacgttgtgtcc
cgctcgatgacgatcgaaatccgcgagggacgcggttgcggtccggagaaggatcatgtc
tacctgcagctgcaccatctgcccccagagcagctggcccagcgcctgccgggcatttcg
gagacggcaatgattttcgccggcgttgatgtaacccgcgaacccattcccgtactgccg
accgtgcattacaatatgggtggcgtaccgacgaactacaagggccaggtgctgaccacg
caaaatggtgccgatcgtgttgtgccgggattgtacgcttgcggtgaggccgcttgttcc
tcggtgcacggtgcaaatcgtctcggtgccaattcgctgctcgatctcgtggtgttcggt
cgtgcctgcgccaaaacgatcgctgaggagaatcgtccaggagagaaggtgcaggatctg
aagccgaatgcgggcgaagcatcggttgccaacttggactgggtgcgtaacgctgacgga
caggtgccgacctcgacgctgcgtttgaatatgcagaagactatgcagacgcatgctgcc
gttttccgcgaggagaaaacgctccaggagggcgtgcgcaagatgggcgacatctacaag
accatcaaggacgtgaaagtgtcggacaggtcactggtgtggaactcggatctggtggaa
acgcttgagctgcagaatttgctgctgaacgcaaacatgaccatcgtcgctgctgaaaac
cgtaaggaatcgcgcggtgcccatgctcgtgaggactacaaacaacgtgtcgacgaatac
gactttagcaagccgctcgagggacagcagaagaagccggtggaagagcactggcgtaaa
catacgctgacgtggatcgatccagccaccggtaacgtcaccatcgactaccgtccggtc
attgacgaaacgctcagcgaggaatgtgctaccgtgccgccagccattcggtcttattaa

DBGET integrated database retrieval system