KEGG   Anopheles gambiae (mosquito): AgaP_AGAP011161Help
Entry
AgaP_AGAP011161   CDS       T01036                                 

Definition
(RefSeq) AGAP011161-PA
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00030  Pentose phosphate pathway
aga01100  Metabolic pathways
aga01200  Carbon metabolism
aga01230  Biosynthesis of amino acids
Module
aga_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
aga_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AgaP_AGAP011161
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    AgaP_AGAP011161
Enzymes [BR:aga01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     AgaP_AGAP011161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh TPP_enzyme_C DXP_synthase_N XFP_N DHDPS
Motif
Other DBs
NCBI-GeneID: 1270768
NCBI-ProteinID: XP_309488
VectorBase: AGAP011161
UniProt: Q7QHE9
LinkDB All DBs
Position
3L
AA seq 627 aa AA seqDB search
MPTYHKPEAKTIQELKDIAHKLRIDSINATQASKSGHPTSCASIAEIMSVLFFNTMRYKL
SAPRDPSSDRFILSKGHAAPILYAAWAEAGLFPVEDLMNLRKIDSDLEGHPTPRLNFIDV
GTGSLGQGVAVACGMAYVGKNLDKADYRTYVLVGDGESAEGSIWESLHFAGYYKLNNLCV
IFDVNRLGQSEATSLQHQMEVYRKRLDAFGFNAIVVDGHDVEELCKAFFEAASTTDRPTA
IIAKTYKGKHFPNIEDLENWHGKPLGDAAADVVAHLQKQIRNPGPIALAPPSPQKESAPK
VSIKGVELATPPAYQKGEQVATRLAYGTALAKIAMNNDRVIALDGDTKNSTYSDKLRKAF
PERFIECFIAEQNLVGVAIGAACRDRTVAFVSTFATFFTRAFDQIRMGAISQTNVNFVGS
HCGVSIGEDGPSQMGLEDIAMFRAIPGSTVFYPADAVSTERAVEMAANTPGVCFIRTSRP
NTAVIYENNEKFEIGKCKVVKQNANDSVLLIGAGITLYEALKAAEELEKSGIHCRVIDPF
TVKPLDQEGIIKHGAQCGGRVVVVEDHYKQGGLGEAVLSALAEQRNFVVKHLGVDKLPRS
GPPTVLVDMFGISARSVAAAVQEIIKM
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgccgacctatcacaagccggaagccaaaaccatccaggagctgaaggatatcgctcac
aagctgcgtatcgattcgatcaacgcaacgcaagcgtcaaagtctggccacccgacatca
tgtgcgtcgattgcggaaatcatgtcggtgctgttcttcaacacgatgcggtacaaactc
tctgctccacgcgatccctcctccgaccggttcatcctgtcgaagggtcacgcggccccc
atcctgtacgcggcctgggccgaggctggcctgttcccggtcgaggatctgatgaatctg
cgcaagatcgactcggatctggagggccatccgacgccgcgcctcaactttatcgatgtg
ggcacgggctcgctcgggcagggggtggccgtcgcctgcggcatggcgtacgtcggcaag
aacctcgacaaggcggactaccgcacgtacgtgctggtcggggacggtgaatcggccgaa
ggttcgatctgggagtcgctgcactttgccggctactacaagctgaacaacctgtgcgtt
atcttcgacgtgaaccggctcggccagtcggaggcgacctcgctgcagcaccagatggag
gtgtaccgcaagcggctggacgcgttcggcttcaacgcgatcgtcgtcgacgggcacgac
gtggaggagctgtgcaaggcgttcttcgaggcggcgtccacgaccgaccggcccacggcc
atcatcgccaagacgtacaagggcaagcacttcccgaacattgaggatctggagaactgg
cacggcaagccgctgggcgatgcggccgccgatgtggtggcgcatctgcagaagcaaatc
cgcaacccgggaccgatcgcgctggcgccaccgtcgccgcagaaggagagcgccccgaag
gtcagcatcaagggggtggagttggccaccccgccagcgtaccagaagggggagcaggtg
gcaacgcgacttgcctacggtaccgcgctggccaagatcgcgatgaacaacgatcgcgtc
attgcgctggacggtgacacgaagaactcgacctactcggacaagctgcgcaaagcgttc
ccggagcgcttcatcgagtgcttcatcgcggagcagaatctggtcggggtggcgattggg
gcggcgtgccgtgaccggaccgtggcgttcgtgtccacctttgccacgttcttcacgcgt
gcgttcgaccagatccgcatgggtgcgatctcgcagacgaacgttaactttgtcggctcg
cactgtggcgtgagcatcggcgaggacggcccgagccagatgggcctggaggacattgcg
atgttccgggcgatcccgggcagcaccgtgttctatccggcggatgccgtcagcacggag
cgtgcggttgagatggccgccaacacgccgggcgtgtgctttatccgtacgtcgcgcccg
aacactgccgtcatctatgagaacaacgagaaattcgagattggaaagtgtaaggtggtg
aagcaaaacgccaacgattcggtactgctcatcggtgccggtatcacgctgtacgaagcg
ctgaaggctgccgaggagctggagaagagcggaattcactgccgcgtcatcgatccgttc
acggtgaaacccctcgaccaggaaggtatcatcaagcatggtgcccagtgcggtggacgt
gtcgtcgtcgtcgaggatcactacaaacaaggtggccttggcgaggcggtcctgtctgcc
ctggccgaacagcgcaactttgtcgtgaagcatctcggcgtggacaagttgccccgctcc
ggaccgcccaccgtgctcgtcgatatgtttggcatttcggcacgttccgttgcggccgcc
gtgcaggagatcattaagatgtaa

DBGET integrated database retrieval system