KEGG   Anopheles gambiae (mosquito): AgaP_AGAP011514Help
Entry
AgaP_AGAP011514   CDS       T01036                                 

Definition
(RefSeq) AGAP011514-PA
  KO
K05692  actin beta/gamma 1
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga04145  Phagosome
aga04391  Hippo signaling pathway - fly
aga04745  Phototransduction - fly
Brite
KEGG Orthology (KO) [BR:aga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04391 Hippo signaling pathway - fly
    AgaP_AGAP011514
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    AgaP_AGAP011514
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    AgaP_AGAP011514
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aga03021]
    AgaP_AGAP011514
   03019 Messenger RNA biogenesis [BR:aga03019]
    AgaP_AGAP011514
   03036 Chromosome and associated proteins [BR:aga03036]
    AgaP_AGAP011514
   03029 Mitochondrial biogenesis [BR:aga03029]
    AgaP_AGAP011514
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aga04812]
    AgaP_AGAP011514
   04147 Exosome [BR:aga04147]
    AgaP_AGAP011514
Transcription machinery [BR:aga03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     AgaP_AGAP011514
Messenger RNA biogenesis [BR:aga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     AgaP_AGAP011514
Chromosome and associated proteins [BR:aga03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     AgaP_AGAP011514
    NuA4 complex
     AgaP_AGAP011514
  Chromatin remodeling factors
   BAF complex
    AgaP_AGAP011514
   PBAF complex
    AgaP_AGAP011514
   SWR1 complex
    AgaP_AGAP011514
Mitochondrial biogenesis [BR:aga03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    AgaP_AGAP011514
Cytoskeleton proteins [BR:aga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     AgaP_AGAP011514
Exosome [BR:aga04147]
 Exosomal proteins
  Proteins found in most exosomes
   AgaP_AGAP011514
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin GerD
Motif
Other DBs
NCBI-GeneID: 1275976
NCBI-ProteinID: XP_315271
VectorBase: AGAP011514
UniProt: Q7Q7K4
LinkDB All DBs
Position
3L
AA seq 233 aa AA seqDB search
MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDSYVGDEAQ
SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatgatgatgcgggagcacttgtcgttgacaacggatccggaatgtgcaaggcc
ggattcgccggtgatgacgccccacgtgccgtcttcccgtccattgttggccgtccccgt
caccagggtgtgatggtcggtatgggcaacaaggactcgtacgtcggtgatgaggcccag
tccaagcgtggtatcctcaccctgaagtacccgatcgagcacggtatcatcaccaactgg
gatgatatggagaagatctggcaccacaccttctacaatgagctgcgcgtcgccccggag
gagcacccagtcctgctgactgaggccccgctgaacccgaaggctaaccgcgagaagatg
actcagatcatgtttgagaccttcaactcgccggccatgtacgtcgccatccaggccgtg
ctgtccctgtacgcttccggtcgtaccaccggtattgtgctggactccggcgatggtgtc
tcccacaccgtcccaatctatgaaggttatgctctgccgcacgccatcctccgtctggat
ctggctggtcgcgatctgaccgactacctgatgaagatcctgaccgagcgcggctactcg
ttcaccaccacggctgagcgtgaaattgtccgcgacatcaaggagaagctgtgctacgtc
gctctggacttcgagcaggaaatggccaccgccgctgcc

DBGET integrated database retrieval system