KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012400Help
Entry
AgaP_AGAP012400   CDS       T01036                                 

Definition
(RefSeq) AGAP012400-PA
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00052  Galactose metabolism
aga00500  Starch and sucrose metabolism
aga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AgaP_AGAP012400
   00500 Starch and sucrose metabolism
    AgaP_AGAP012400
Enzymes [BR:aga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     AgaP_AGAP012400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 1280462
NCBI-ProteinID: XP_320158
VectorBase: AGAP012400
UniProt: Q7Q0D7
LinkDB All DBs
Position
3L
AA seq 599 aa AA seqDB search
MALYYWLALLLLGWSTVTAQKDWWESASFYQIYPRSFQDSNGDGIGDLNGIKSRLPYLKS
LGMTAFWLSPIYPSPMADFGYDISNFMDIHPSFGTLADFKQLVEEAKKLQLRIILDFVPN
HSSDEHEWFKKSVQRVSGYEDYYVWQDPKPGTERDPPNNWVAAWYGSAWEWNDERKQFYL
HQFHKKQPDLNYRNPAVVQAMKDVLRFWLDQGVDGFRIDAVPWLFETVGFPDEPVSGHST
DPLSQNYLTHIYTLDQPETVDMVYQWRELMDQYKQEHNTTTKVLMTEAWSSLDVVKTYFN
DSNNRQGSQMPFNFQLIMRLDQNSKASDFQTVINSWLDIIPPGHTPNWVLGNHDKRRVSS
RMGGDHMVDIMAMIELTLPGITVTYQGEEIGMHDVDISWADTQDPAACQLTEETYQEGTR
DPARTPFQWDSTANAGFTNASVKPWLPLATDYPLVNVKTQQESAQNSHIKVFKELMNLRG
TNTLIWGSFKSLVLGENVYAILRSFPNDKRTYVVLANIGSKSEIIDATKLDNSLPNELVF
RVVSVSSNHITGESVATNNILLQPYEAVVLANHAIRLAQQLYVLIGAFGMLVGVQLFKA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggccctctactactggctagctttactactgttgggctggtctactgtgaccgcccag
aaggattggtgggaaagtgcgagcttctatcaaatctatccgcgatcgtttcaagatagt
aacggcgatggaataggcgatcttaatggcatcaaaagtcggttgccgtatctgaagtca
ctcggtatgactgcattttggctttccccgatctacccttcgccgatggccgactttggg
tatgatatctccaactttatggacattcatccgagctttggaacgttggctgactttaag
cagctggtggaagaagcgaaaaaactgcaattacgcatcatcctcgacttcgtgcctaac
cattcgagcgacgagcatgagtggttcaagaaaagcgttcagcgagtaagtgggtacgaa
gactattacgtgtggcaggatcccaaaccgggcacggaacgcgaccctccaaacaactgg
gttgcagcatggtacggttcggcgtgggaatggaatgacgaaagaaagcaattttatttg
caccagtttcacaagaagcagcccgatctgaactaccgcaacccggccgtggtgcaggct
atgaaggatgtgttgcgcttctggttggaccagggcgtcgacggcttccgtattgatgcg
gtcccgtggctgttcgagacggtgggtttcccggacgaacctgttagcggtcattccacc
gatccgttaagtcagaactaccttacccacatttatacgctcgatcaaccggaaaccgtt
gacatggtgtatcaatggcgggaattgatggatcagtacaaacaagagcacaataccacc
accaaagtgctcatgaccgaggcatggtcctcgttggatgttgtaaaaacgtacttcaac
gacagtaacaaccggcaaggatcgcaaatgccgttcaacttccagttaatcatgcggctg
gatcaaaattctaaagcatccgattttcagacggttattaactcgtggctggatatcatt
cctcctggccacacgcccaactgggtgcttggtaatcacgacaaacgtcgtgtttcgtca
cgaatgggtggagaccatatggtagacataatggctatgatcgagctcaccttacccggc
ataacggtcacttaccagggagaagaaattggaatgcatgacgttgatatctcgtgggcg
gacactcaagatcctgctgcatgccagctgaccgaagagacgtatcaggaaggtacacgc
gacccagccagaacaccgttccagtgggattctactgcaaacgcaggttttacgaacgct
tctgtaaaaccgtggcttccgctagctaccgattatccgctggtgaacgtaaaaacacaa
caagaatcagcccaaaacagtcatataaaggtgttcaaggagctgatgaacttacgcggc
acgaacacgcttatctggggctcgtttaagtcactggtacttggcgaaaatgtgtacgct
atactgcgttctttccccaacgacaaacgaacatatgtcgtgctggcaaacattggctcc
aagagcgaaataattgacgctacaaaactggacaacagtttaccgaacgagcttgtgttt
cgcgtggtaagcgtatcgtcaaatcatatcaccggagaatcggtcgcaacaaacaacatt
cttttacagccttacgaagccgtagttttggctaaccatgcaattcgactggcgcagcag
ctttatgtattgatcggtgcttttggtatgttggtgggtgtgcaattgtttaaggcgtaa

DBGET integrated database retrieval system