KEGG   Agrobacterium sp. RAC06: BSY240_1247Help
Entry
BSY240_1247       CDS       T04501                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
agc  Agrobacterium sp. RAC06
Pathway
agc00473  D-Alanine metabolism
agc01100  Metabolic pathways
agc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:agc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSY240_1247 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BSY240_1247 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:agc01011]
    BSY240_1247 (alr)
Enzymes [BR:agc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BSY240_1247 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:agc01011]
 Precursor biosynthesis
  Racemase
   BSY240_1247 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AOG08480
UniProt: A0A1B3NSZ8
LinkDB All DBs
Position
1279721..1280887
Genome map
AA seq 388 aa AA seqDB search
MTDRFTILDAPEEFLSAPLRLTVDLSAIADNWREMARRSGKARTAAVVKADAYGLGIEDV
GQVLYHAGARDFFVAVPAEGATLRPYAPEARIFVLSGIWPGQEEIFFQNDLVPVIASEEQ
LAFWMAVLTERGPYPCALHVDTGFNRLGLPMADALALTDDVSRPASLDPVLVMSHLACGD
DPSSPMNRQQLEKFREVSAAFEGVDSSLSASAGIFLGSDYHFDLTRPGIALYGGEAVSGA
RNPMQPVVKAEARILQIREAKAGESVSYGATHVLARDSRLAVTSVGYADGYLRNLSGSGI
ALRGTGIAGAEGVIAGRRVPVVGRVTMDLTVFDITDLPDNAVRSGDYIELLGPSMPLDEV
ARAAGTIGYEMLTGLGLRYERIYLEGED
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccgtttcaccatcctcgatgcgccggaggaatttctttcggcaccgctgcgc
ctgaccgtggatctctcggcgattgctgataactggcgagagatggcacgccgctccggc
aaggcccggacggccgccgtcgtcaaggcggatgcctatggtctcggcatcgaggatgtc
ggtcaggttctgtatcacgcgggcgcccgcgacttcttcgtcgcggtgccggcggagggg
gccacactccgcccctatgcgcccgaggctcgcatcttcgtgctgtcaggcatctggccg
ggccaggaagagatcttcttccagaacgatctcgtgcccgttatcgcatccgaggaacag
cttgccttctggatggcggtgctcaccgagcgcggcccatacccttgcgccctgcatgtc
gataccggcttcaaccggctgggactaccgatggccgacgcgctggcgctgaccgacgac
gtctcgcgtccggcaagcctcgatccggttctggtcatgagccatctcgcctgcggcgat
gatccgtcttcgccgatgaaccgccagcaactcgagaaattccgggaggttagcgcggct
ttcgaaggtgttgattccagcctctcggcatctgccggcatcttcctcggctcggattac
cactttgatctcacccgtcccggaatcgcgctctatggcggggaggctgtcagcggcgcc
agaaacccgatgcagccggtggtcaaggccgaggcccgcatcctgcagatccgcgaggca
aaagccggcgaaagcgtctcttacggcgcaacgcatgtgctggcgcgcgacagccggctc
gccgttacgagcgtcggttatgcggatggctatctgcgcaatctctccggctcgggtatc
gccttgcgcgggacaggaattgctggtgcagagggggtgatcgccggtcggcgtgtgccg
gtcgtcggccgggtcaccatggatctcaccgtcttcgacatcaccgatctgcccgacaat
gcggtgcgcagcggcgactatatcgaactcctcggcccctccatgccgctcgacgaggtg
gcccgcgccgccggcacgattggttacgaaatgctcaccggacttgggctgcgctatgaa
cggatctatctcgagggggaagactga

DBGET integrated database retrieval system