KEGG   Agrobacterium sp. RAC06: BSY240_1943Help
Entry
BSY240_1943       CDS       T04501                                 

Gene name
ntrB
Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
agc  Agrobacterium sp. RAC06
Pathway
agc00910  Nitrogen metabolism
agc02010  ABC transporters
Module
agc_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:agc00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BSY240_1943 (ntrB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSY240_1943 (ntrB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:agc02000]
    BSY240_1943 (ntrB)
Transporters [BR:agc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    BSY240_1943 (ntrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AOG11786
UniProt: A0A1B3P2G1
LinkDB All DBs
Position
complement(1966886..1967782)
Genome map
AA seq 298 aa AA seqDB search
MTATARKIDTEATAISATRTGTVVMIAQRPTRKIDLQKAIAAICRNVLPPLVVLIALLGI
WQIACSNPGATLPPPSQVWIDSYDLIAAPFFDYGPQDIGLAWRVLVSLERVAIGFGLAAV
VGVFLGAVVGQSVWAMRGLDPIFQILRTVPPLAWLPLSLAAFQNSNPSAIFVIFITSIWP
IIINTAVGVRNIPDDYRNIARVLRLNPLEFFIRIMVPAAAPYIFTGLRIGIGLSWLAIVA
AEMLTGGVGIGFFIWDAWNSSRLSDIIVALAYIGVTGFVLDKLVAFLGNVITRGTAKN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaaccgcccgcaagattgacaccgaggcgacggccatttcagcgaccaggaca
ggcacggtcgtcatgatcgcacaacgcccgacccgcaagatcgacctccagaaggcaatc
gccgccatctgtcgcaatgtcctgccgccgcttgtggtgctgatcgcgctactcggtatc
tggcagatcgcctgctcaaatccgggcgccacgctgccgccaccatcacaggtgtggatc
gacagctatgatctgatcgccgccccgttctttgattatgggccgcaggatatcggcctt
gcctggcgcgttctcgtctcgctcgagcgtgtcgcgatcggcttcgggctcgccgccgtc
gtcggcgtctttctcggtgccgttgtcggtcagtctgtctgggcgatgcgtggtctcgac
ccgattttccagatcctgcgcacggtaccgccgcttgcctggctgccgctctcgcttgct
gccttccagaattcaaatccgtcggcgatcttcgtcatcttcatcacctcgatctggccc
atcatcatcaacaccgctgtcggcgtgcgcaacatccccgacgactatcgcaacattgcc
cgcgtgctgcgcctcaacccgctggaattcttcatccgcatcatggtgccggccgccgcc
ccttacatcttcaccggtcttcgcattggcatcggcctctcctggctcgcgattgttgcc
gcggaaatgctgaccggcggtgtcggcatcggcttcttcatctgggatgcgtggaattcc
tcgcgtctctccgacatcatcgtggcgctcgcctatatcggcgtgaccggctttgtcctc
gacaagctcgtcgcattcctcggcaacgtcatcacccgcggcaccgcgaagaactga

DBGET integrated database retrieval system