KEGG   Agrobacterium sp. RAC06: BSY240_207Help
Entry
BSY240_207        CDS       T04501                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
agc  Agrobacterium sp. RAC06
Pathway
agc00473  D-Alanine metabolism
agc00550  Peptidoglycan biosynthesis
agc01100  Metabolic pathways
agc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:agc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSY240_207
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSY240_207
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BSY240_207
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:agc01011]
    BSY240_207
Enzymes [BR:agc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BSY240_207
Peptidoglycan biosynthesis and degradation proteins [BR:agc01011]
 Precursor biosynthesis
  Amino acid ligase
   BSY240_207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AOG08653
UniProt: A0A1B3NTH7
LinkDB All DBs
Position
224008..224934
Genome map
AA seq 308 aa AA seqDB search
MSGKHVAVLMGGLSSERPVSLSSGNACASALEGEGFKVTRVDVGRDIGRVLEDLKPDVAF
NALHGPYGEDGTIQGVLEYLEIPYTHSGVLASALAMDKKQAKIVAAQAGIPVAEAMVINR
FDVGNMHPMAPPYVVKPVREGSSFGVVIVREDMAHPPQILTSSEWRYGDLVMVERYVAGR
ELTCGVMDGKVLGVTEIVPLGNSFYDYDSKYAAGGSEHVLPAQISPKIYQKIQSLALKAH
QALGCRGVSRSDFRYDDRFSEDGDLIWLELNNQPGMTPTSLLPEMAALAGYSFGEFVRWM
VEDASCSR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcaagcatgtcgcggttttgatgggtggattgtcctccgagcggcctgtgagc
ttgtcctctggcaacgcctgcgcttcggctctcgagggtgagggcttcaaggtcacgcgc
gttgatgtcggtcgcgatatcggtcgtgtcctcgaagatctgaagccggatgtcgccttc
aatgcgctgcatggtccctatggcgaagatggcaccattcagggcgtgcttgaatatctc
gagatcccctacacccattccggcgtgcttgcgtcggcacttgccatggacaagaaacag
gcgaagatcgtggccgcccaggccggcattcctgtcgccgaagccatggtcatcaatcgc
ttcgacgtcggcaacatgcatccaatggcgccgccctatgtcgtgaagccggttcgtgag
gggtcgagcttcggtgtagtcatcgtccgcgaggatatggcgcacccgccgcagatcctg
acgtcaagtgaatggcgttacggcgatctcgtgatggtcgagcgttatgtggcgggtcgc
gaactgacgtgcggcgtgatggatggcaaggtgctcggcgtcaccgagatcgtgccgctc
ggcaacagcttctacgattacgactccaagtatgcggcgggtggttcggagcacgtgctt
cctgcgcaaatttcaccgaaaatttaccaaaaaatacaatcattagcgctgaaggcacat
caggcgctcgggtgtcgcggagtgagtcggtccgacttccgctatgacgatcgcttctcc
gaggatggtgatctgatttggctggagcttaacaaccagccgggcatgacccccacttcg
ttgctgcctgaaatggctgcccttgcgggctacagctttggtgaattcgtacgttggatg
gtggaggacgcttcttgttctcgttga

DBGET integrated database retrieval system