KEGG   Agrobacterium sp. RAC06: BSY240_2160Help
Entry
BSY240_2160       CDS       T04501                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
agc  Agrobacterium sp. RAC06
Pathway
agc03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:agc00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BSY240_2160 (ligD)
Enzymes [BR:agc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BSY240_2160 (ligD)
DNA repair and recombination proteins [BR:agc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BSY240_2160 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AOG10868
UniProt: A0A1B3NZS8
LinkDB All DBs
Position
2191822..2194410
Genome map
AA seq 862 aa AA seqDB search
MSLSEYRRKRDFKATPEPKAAKVTSKGNSFVIQKHAARRLHYDLRLEMDGVLKSWAVTRG
PSLVPGEKRLAVHVEDHPLAYGDFEGVIPPGQYGSGEVIVWDRGTWEPLHDTGKGYKKGH
LEFTLKGEKLGGHWHLVRMARKEDETRENWLLIKGEDEAARQPDDPDIIEEKPLSVKSGR
SIESLKGDGKAAVWNSRKTSKSSKTGKTPATRHASSSQSGSKIKGTKPGSLPEFLPPALA
RLVKSAPKGDRWLHEIKLDGYRIQARIDHGRVQLLTRTGLDWTERFGERIASALKGLPVQ
TALLDGEIVVESGNGSSDFSLLQQDLSDGRDDRFTHYLFDIMYLDGEDLTGASLRDRKAV
LESLISEVSLPLKYSSHFDESGDLVLKHACRLSLEGVISKVADAPYRSGRGRDWVKSKCT
ARQELIIGGYVPSSVSDKAIGSLIMGVNEVDGLRHVGRVGTGYSRTLARQIFTKLQPLLR
DKSPFKDKLTGTERKDAVFVEPEIVAEIEFRGWTGDAHLRHASFRGLREDKAARDVVQEA
PTETASTKKAGAGKTGSSTDRKKKAEAQAARRAITLTHPDRLYWPEAGVTKEGLADYYAM
VWPRIAPFIVDRPLALLRCPEGHEKTCFFQKHGWRGMRKEIITIRDPKDDEGHVGIHDIE
GLLSLVQGAALEIHPWGSRAGDLERPDMVNIDLDPGPDVTWERVIEAAFEVRQRFEEMGL
TGFVKTSGGKGLHVVAPLKPKAKWPEVKAAMKALADGMSADSPTDYVSTVSKAKRKGKIL
IDYLRNGRGATAVAPYSTRARAGAPVSMPLAFEELSPHILPNHFTVENVPARLASLDADP
WADFRRAEAPLASTDGKKRKTR
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctctccgagtatcgccgcaaacgcgacttcaaggccacgccggaaccgaaggcc
gcaaaggtcacgagcaagggcaacagtttcgtcatccagaaacatgcggccagacgcctg
cattacgacctgcgtctggaaatggacggtgtgctgaaaagctgggccgtcacgcgcggt
ccgagcctcgtgccgggcgagaagcggctggcggtgcatgtggaggatcaccctctcgct
tacggcgacttcgaaggtgtcatcccgcccggacaatacggatccggcgaagtgatcgtc
tgggaccgtggtacgtgggaaccgctccacgacaccggcaaaggttacaagaagggccac
ctcgagttcacgctgaagggcgagaaactcggcggacactggcatctggtgcgcatggcg
cgcaaggaagacgaaacacgcgagaactggctgttgatcaagggagaagacgaggcggca
cggcaaccggatgatcccgacatcatcgaggagaagccgctttcggtgaagagcggccga
tcgatcgaaagtctgaagggcgatggcaaggctgccgtctggaactcacgcaagacgtca
aaatcatccaagacagggaagacgccagcaactcgccatgcctcttccagccagagtggc
tctaagatcaaggggacaaagccaggcagcctcccggagtttctgccgcctgcccttgcg
cgcctggtcaagtcggcccccaagggtgatcgatggttgcacgaaatcaagctggacggt
taccggatccaggcacggatcgatcatggtcgggtgcagctattgacgcggacgggtctg
gactggacggagcgcttcggtgagcggatcgcatcggccctcaaggggctgcctgttcag
accgcgctgctcgatggtgaaatcgtggtcgagagcggcaatggcagcagcgacttttcc
ctgctgcagcaggatctgagcgacggtcgcgatgatcgcttcacacactacctcttcgat
atcatgtatcttgacggagaggatctgacgggtgcctcgctcagggaccgcaaggcagtg
ctggagtcattgatcagcgaggtcagcctaccgctcaaatattccagccatttcgacgag
agcggtgatctcgtcctcaaacatgcctgccgcctcagtctcgaaggggtgatctccaag
gtcgccgatgcgccctatcggtccggccgcggacgggattgggtcaagtcgaaatgtacg
gcccgccaggaactgatcatcggcggctatgtgccctcctccgtttcagacaaggccatc
ggttctctgatcatgggcgtcaacgaagtggacggactgcgccatgtcgggcgtgttggc
accggatacagccgaacgctggcccggcagatattcaccaagcttcagccactgttgcgc
gacaagagcccgtttaaagacaagctgacgggcaccgaacgaaaggacgcggttttcgtc
gagccggagattgtcgccgagatcgagtttcgcggatggacgggagacgctcacctgcgc
catgcctccttccgggggctgcgcgaggacaaggccgcacgggacgtggtccaggaggcg
ccgacggaaactgcatcgaccaagaaggcaggggctggcaagactggctcgtcaacggac
aggaagaaaaaggccgaagcgcaggctgcacgccgtgccattaccctgacacatcccgac
cggctctattggcctgaggccggcgtcacgaaggaagggcttgcggactactacgccatg
gtctggccccgtatcgccccgttcatcgtcgaccgaccactcgccttgttgcgatgcccc
gaggggcacgagaagacgtgctttttccagaagcatgggtggcgtggcatgcgcaaggag
atcatcaccatccgcgacccgaaagacgacgagggtcacgttggaatccacgatatcgaa
gggctgttgtccctggtgcagggggcggcgctcgaaatccacccctggggctcgcgagcg
ggcgatctcgagcggcccgacatggtgaacatcgacctcgatcccggtcctgatgtcacc
tgggaacgggtgattgaagcggccttcgaggtgcgtcagcgctttgaagaaatgggcctt
accggtttcgtcaagacatccggtgggaaaggcctgcatgtggtggcgccactcaaaccg
aaggcgaaatggcctgaagtcaaagcggccatgaaggcactggcggacggcatgagcgct
gacagtccgaccgattacgtctcgacggtcagcaaggcaaaacgcaagggaaagatcctg
atcgactatctgcgcaatggcaggggggcaacggcggtcgccccctattccacacgagcc
cgggccggcgctccggtgtcgatgccgctcgcgttcgaggagttgagcccccacatcctt
cccaaccatttcacggtcgaaaacgtgcctgcgcggctggcgagcctcgatgccgatccg
tgggccgatttccgcagggccgaagcgccgttggcatcaacagacgggaaaaagaggaag
acccgctag

DBGET integrated database retrieval system