KEGG   Agrobacterium sp. RAC06: BSY240_2315Help
Entry
BSY240_2315       CDS       T04501                                 

Definition
(GenBank) sulfite exporter TauE/SafE family protein
  KO
K07090  uncharacterized protein
Organism
agc  Agrobacterium sp. RAC06
Brite
KEGG Orthology (KO) [BR:agc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSY240_2315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE PAP2_C
Motif
Other DBs
NCBI-ProteinID: AOG09216
UniProt: A0A1B3NV24
LinkDB All DBs
Position
2384376..2385293
Genome map
AA seq 305 aa AA seqDB search
MTIYLPIAELSVNVFIILGMGAAVGFLSGMFGVGGGFLITPLLIFYNIPPVVAVATGANQ
VVASSVSGAISHFRRGTLDMKLGTVLLIGGLVGATIGVYIFSWLRRLGQLDLIISLLYVV
FLGTVGGLMLAESLRALRRAARNEAVPLKRPGQHNWVHRLPFKMRFKKSKIYLSVIPILA
LGFGIGILTSVMGVGGGFIMVPAMIYLLRIPTNVVVGTSLFQIIFTTAYTTIVQAATNYS
VDIVLAFILMVAGVIGAQYGVRVGQKLRGEQLRALLGLLVLAVGVRLAIELVVTPDDIYS
LAIGG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatctatctgccgatcgccgagttgtcggtcaatgtgttcatcattctcggcatg
ggcgcggctgtcggcttcctctcgggcatgttcggggtcggtggcggcttcctcatcacg
ccactcctgatcttctacaacattcctccagtcgtcgccgttgcaaccggcgcgaaccag
gtcgtggcttcctccgtatcgggtgccatttcgcatttccggcgcggtacgctggatatg
aagcttggaacagttctgctgataggaggtctggtcggtgcgacgatcggtgtctacatc
ttctcgtggctgaggcgtctcggtcagctcgacctgatcatctcgctgctatacgtggtg
ttcctcggcacggtcggtgggttgatgttggcggagagcttgcgggcgcttcgccgggcc
gcccgcaatgaagccgtccccctgaagcggcccgggcagcacaactgggtgcatcgtctg
cccttcaagatgcgcttcaagaaatcgaagatctatctgagcgtcatcccgatcctcgcg
ctcggtttcggcatcggcatcctgacttcggtcatgggtgtcggcggcggcttcatcatg
gtcccggccatgatctatctgctgcgcattcccacaaatgtcgtcgtcggcacctcgctc
ttccagatcatatttaccaccgcctacaccacgatcgtccaggcggcgacgaactattcc
gtcgatatcgtgctcgccttcatcctgatggtggccggcgtgattggcgcgcaatatggc
gtgcgtgtcggccagaagctgcgcggcgaacagttgcgcgcgctgctggggcttctcgtg
ctcgccgtcggcgtgcgtctcgcgatcgaactggtcgtgacgcccgacgacatctactct
ctggcgatcgggggctga

DBGET integrated database retrieval system