KEGG   Agrobacterium sp. RAC06: BSY240_240Help
Entry
BSY240_240        CDS       T04501                                 

Definition
(GenBank) thymidine kinase family protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
agc  Agrobacterium sp. RAC06
Pathway
agc00240  Pyrimidine metabolism
agc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSY240_240
Enzymes [BR:agc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BSY240_240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 ArgK AAA_14 ATPase_2 DUF2075
Motif
Other DBs
NCBI-ProteinID: AOG10034
UniProt: A0A1B3NXH7
LinkDB All DBs
Position
260236..260835
Genome map
AA seq 199 aa AA seqDB search
MAKLHFIYATMNAGKSTLLLQAAYNYRERGMRVAMLISALDNRAGKGFIGSRIGLKAEAD
AFGQEEDLFAAIKADHETSPLSCVFIDEAQFMTTDQVWQLARVVDVLDLPVMAYGLRTDF
RGELFPGSKALLAIADELTEARSICHCGRKATMVVRVGEDGKAQRDGAQVLIGGNETYTS
LCRRHWQLAFAAEEVTASK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttggccaaacttcatttcatctatgccaccatgaatgctggcaaatcgacgcttcttttg
caggctgcgtacaactaccgcgaacgcggtatgcgggtggcaatgctgatcagcgcgctg
gacaatcgcgcgggcaagggcttcatcgggtcgcggatcggtttaaaggccgaggccgat
gcctttggtcaggaagaagatctcttcgccgcaatcaaggccgatcacgagacttcaccg
ctctcctgcgtcttcatcgacgaggcacagttcatgacgacggatcaggtctggcagctt
gcgcgggtcgtcgatgtgctcgacctcccggtcatggcctatggtctcagaacggatttc
cgcggtgaacttttccccggctccaaggcgctgctcgcgattgccgacgaactcaccgag
gcccgttccatctgccattgcggccgcaaggcgaccatggtcgttcgtgtcggcgaagac
ggcaaggcacagcgggacggtgcgcaggtgctgatcggtggaaacgagacctacacctct
ctctgccgccgtcattggcaattggccttcgccgcggaagaagttaccgccagcaagtga

DBGET integrated database retrieval system