KEGG   Agrobacterium sp. RAC06: BSY240_2735Help
Entry
BSY240_2735       CDS       T04501                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
agc  Agrobacterium sp. RAC06
Pathway
agc00564  Glycerophospholipid metabolism
agc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:agc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSY240_2735
Enzymes [BR:agc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BSY240_2735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_oxidored Pyr_redox_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AOG10093
UniProt: A0A1B3NXK8
LinkDB All DBs
Position
complement(2792947..2794458)
Genome map
AA seq 503 aa AA seqDB search
MSGQPIYDLFVIGGGINGTGIARDAAGRGYSVALAEMNDFASGTSSGATKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPHVIWPLRFVLPFQKGGIRPAWLIRLGLFLYDNLGGRKL
LPPTKTLDLRRDPAGKPLKPVFSKAFEYSDGWVDDARMVVLNARDAQIRGATILSRNRVV
SAHREDGHWVVTTKSQRDGSVVTHKARMLVNAAGPWVDQVLAGAFGRNNVHNVRLVQGSH
IVVRKKFTDPRAYFFQNPDNRIIFAIPYEGEFTLIGTTDRDFTEDPKDVRISPEEVNYLC
DAASEYFQEPVRPDDIVWSYSAVRPLFDDGASKAQEATRDYVLKVEGNSGDAPLLNVFGG
KLTTYRRLAEHALEKIGEAIGEKGASWTAGSRLPGGDFSATAFEPTVDGLIKAYPFLDRI
HAERLIRCYGTDSRAILGKAKSAADLGRHFGGTLYEVEVRWLVETEWAVTAEDVLWRRTK
QGLFLTPEEAKGLDAYLGMLAAA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggcagccaatatacgatctctttgtgatcggcggcgggatcaacgggactggg
atcgcgcgcgacgcggccggccgtggttactccgttgccttggctgaaatgaacgatttc
gcctccggcacctcctcgggcgcaacgaagctcatccatggtggtcttcggtatctcgag
cattacgagtttcgcctggtccgcgaagcgctcatggagcgcgaagtcctctgggccatg
gcgccgcatgtgatctggcctttgcggttcgttttgcccttccagaagggcggcattcgc
cccgcctggctcattcgcctaggccttttcctgtacgataatctcggtggccgaaagctg
cttccgccgacgaagaccctcgatctgcgccgcgatccggccggaaagcctctgaagccg
gtcttctccaaggcgttcgaatattcggacggctgggtcgatgacgcgcgcatggtcgtt
ctcaatgcccgcgatgcacagatccgcggcgcaacgatcctgagccgtaaccgtgttgtc
tcggcccatcgcgaagacggccactgggttgtcacaacaaagtcgcagcgcgacggctcc
gtcgtaactcacaaggcccggatgctggtcaacgcggccggcccttgggtcgatcaggtt
ttggccggtgccttcggccgcaacaatgtgcacaatgtccgtcttgtccagggcagccac
atcgtggttcgcaagaagttcaccgatccacgcgcctacttcttccagaaccccgacaac
cgcatcatattcgccatcccctatgagggtgaattcaccctgattggcacgacggaccgg
gatttcaccgaagacccgaaggacgttcgcatcagccccgaagaggtgaactatctctgc
gatgcggcaagcgaatatttccaggaaccggtacgcccagacgacatcgtctggagctat
tcggccgtgcgtcctcttttcgatgacggcgcctcgaaggctcaggaggcgacgcgcgat
tacgtgctgaaggttgagggtaatagcggcgacgcccccttgctcaatgtcttcggcggc
aagctcaccacctatcgtcgtctggccgaacatgcgctggaaaagatcggtgaagcgatc
ggcgaaaaaggcgcctcttggaccgcaggcagccgactaccgggtggcgatttctcggcc
acggccttcgagccgacggtcgacggactaatcaaagcctatcccttcctggatcgcatc
catgccgagcgcctgattcgctgctacggcacagattcaagagcgatcctcggcaaggcg
aagagcgcggccgatctcgggcgccatttcggcggcacgctgtacgaggtcgaagttcgc
tggctggtggagacggagtgggcggtcacggccgaagacgtgctgtggcgccggacgaaa
cagggactattcctgacgccggaggaggcgaagggactggatgcctatttggggatgctg
gcggcggcctga

DBGET integrated database retrieval system