KEGG   Agrobacterium sp. RAC06: BSY240_725Help
Entry
BSY240_725        CDS       T04501                                 

Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase family protein
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
agc  Agrobacterium sp. RAC06
Pathway
agc00340  Histidine metabolism
agc01100  Metabolic pathways
agc01110  Biosynthesis of secondary metabolites
agc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:agc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BSY240_725
Enzymes [BR:agc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BSY240_725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH DUF4853
Motif
Other DBs
NCBI-ProteinID: AOG09079
UniProt: A0A1B3NUN2
LinkDB All DBs
Position
775344..775796
Genome map
AA seq 150 aa AA seqDB search
MSAFVFDAPSADKKILEEGLAFTPKFDDHGLVTAVVTDARDGELLMVAHMNAEAIALTLE
TGIGHYYSRSRAKIWKKGESSGNLQTVKEIKVDCDQDAIWLKVEVAGHDATCHTGRRSCF
YRTAQLVDGEPSLKIADDHRHFDPDNVYGH
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttttgtgttcgacgccccctcggcagacaagaagatcctcgaggaaggtctc
gccttcacccccaagttcgatgaccatgggcttgtgaccgccgtcgtcaccgatgcgcgt
gacggcgagctgttgatggtggcgcatatgaacgccgaagccatcgcgctgacgctcgaa
accgggatcggtcactattacagccgctccagggccaagatctggaaaaagggcgagagc
tccggcaaccttcagacggtcaaggaaatcaaggtcgactgcgaccaggacgcgatctgg
ctgaaggtcgaggtcgccggtcatgatgcgacctgccataccggacgccgctcctgcttt
tatcggaccgcccagctcgttgacggcgagccgtctctcaagattgccgacgaccaccgg
cacttcgatccggataacgtctacggccattga

DBGET integrated database retrieval system