KEGG   Archangium gephyra: AA314_01336Help
Entry
AA314_01336       CDS       T03948                                 

Definition
(GenBank) Kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
age  Archangium gephyra
Pathway
age00380  Tryptophan metabolism
age01100  Metabolic pathways
Module
age_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
Brite
KEGG Orthology (KO) [BR:age00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AA314_01336
Enzymes [BR:age01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AA314_01336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AKI99709
UniProt: A0A0G2ZJI8
LinkDB All DBs
Position
1588091..1589371
Genome map
AA seq 426 aa AA seqDB search
MSGEAVRYEASEAFARRMDAEDPLRHFRDEFHFPRHHGEPVIYLVGNSLGLQPRKAKPYV
LEALEDWETHGVEGHFRGSHPWMPYHELLTEQTARLVGAHPLEVVVMNTLSVNLHLMLVS
FYRPSGDRRKILIEAGAFPSDQYAVASQVRFHGYSPEEAVLQLSPRPGEETLRTEDILET
IERHGKEIALVLLGNVNYLTGQAFDMAAITRAAHRQGCRVGFDLAHAAGNLQLSLHDDGP
DFAVWCSYKYLNGGPGTLGGVFVHERHARDKTLPRFQGWWGHDKQTRFQMGPDFEPIPGA
EGWQLSNPPILQMAALRASMEIFDRATMPALRRKSERLTGYLEFLLEQLPPGFVRITTPR
DPQQRGAHLSLRFSKEPRKLLEKLTAQGVLCDFRSPDIIRAAPAPLYVSFLDVYRFAGVL
ERHARD
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgaagcggtgcggtacgaggccagtgaggcgttcgcccggcggatggacgcg
gaggatccgctccgccacttccgcgacgagttccactttccccgccaccacggcgagccc
gtcatctacctcgtgggcaactcgctggggctccagccgcgcaaggcgaagccctatgtg
ctggaggcgctggaggactgggagacgcacggcgtggagggccacttccgcggctcgcac
ccgtggatgccctaccacgagctgctcaccgagcagaccgcgcggctggtgggcgcccac
ccgctcgaggtggtggtgatgaacaccctctcggtgaacctgcacctgatgctggtgtcc
ttctaccggccctcgggagatcgccggaagatcctcatcgaggccggtgcgttcccctcg
gaccagtacgcggtggcctcgcaggtgcgcttccacgggtactcgccggaggaggccgtg
ctccagctctccccgcgccccggcgaggagacgctgcgcaccgaggacatcctcgagacg
atcgagcggcacgggaaggaaatcgccctggtgctgctgggcaacgtgaactacctcacc
ggccaggccttcgacatggccgccatcacccgcgccgcgcaccggcagggctgcagggtg
ggcttcgacctggcgcacgcggcgggcaacctccagctgtcgctgcacgatgacgggccg
gacttcgccgtgtggtgctcgtacaagtacctcaacggcggcccgggcacgctgggcggt
gtcttcgtccacgagcgccacgcgcgcgacaagacgctgccccgcttccaggggtggtgg
ggccacgacaagcagacgcgcttccagatggggcccgacttcgagcccattccgggcgcc
gagggctggcagctgtccaacccgcccatcctccagatggcggcgctgcgcgcgtccatg
gagatcttcgatcgcgccaccatgccggccctgcgccgcaagagcgagcgtctcaccggc
tacctggagttcctcctggagcagctcccgcccggcttcgtgcgcatcaccacgccgagg
gatccccagcagcgcggtgcccacctgtcgctgcgtttcagcaaggagccgcgcaagctg
ctcgagaagctcacggcgcagggagtcctctgcgacttccgttcaccggacatcatccgc
gccgcgccggctccgctctatgtcagcttccttgacgtctaccgcttcgcgggagtgctc
gaacggcatgcacgagattga

DBGET integrated database retrieval system