KEGG   Archangium gephyra: AA314_02665Help
Entry
AA314_02665       CDS       T03948                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
age  Archangium gephyra
Pathway
age03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:age00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AA314_02665
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:age03400]
    AA314_02665
Enzymes [BR:age01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AA314_02665
DNA repair and recombination proteins [BR:age03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AA314_02665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AKJ01039
UniProt: A0A0G2ZQM1
LinkDB All DBs
Position
3224239..3226803
Genome map
AA seq 854 aa AA seqDB search
MGTYRAKRDFSLTSEPAPEVPAPRGEGGPIFVVHKHDATRLHYDLRLEIDGVLVSWAIPK
GPSYDPADKRLAVQTEDHPLAYATFEGRIPDGAYGAGDSLLWEEGTFDTVPPGQASEQLA
RGRLHVVLHGHKLEGGWHLIRTRPMGKKAQWLCFKAKDGTEQPGYDVTVEHPESVKSGQS
ATRGPGRRTRRTAAQRAPAKPVRASRPARTKGSARTPEALLGKVWPPMLATLAQVDATAD
ADWRFEVKYDGFRAIAAFQGGRIALQSRNGNDLSSRFPTIFQALEALGEHEAVVDGEIVA
LDPKGRSRFQLLGKGVEERYVIFDVLWLEGEDVRSLPLEERRARLERLLEGVKPPLEIAE
QVKGSAKQSLSQAKRRGLEGVMAKRVGSPYTPGRGADWLKLKVQANQEVAIVGFTPMANE
RPELGSLLVAVREGDTWKYAGKVGTGYSTKVRRELRTLLARDVVKKSPVKDAPYVRDALH
NEEAFWVKPRYVAQVAFTEWTEDGRLRHPSFQGLRSDKRPEECVREKPRSTPVRATRGPH
RRTGTKTRQATRAAGRTAVARKQATRAPSPVAPVVLTHGERVLFPQKGFTKADVFAYFRD
VAPLMVPALTGRPLALQQWPRGVDEPGFFRQGVQGTPDWLTTTCIHHEARSLPHVVVDRP
ESLLWLANQSALTLHIWSSRVEHLEEPDWVVFDLDPGPAGTFDDLIQLTLSLRRYLEGLG
LASVPKTSGKRGLHVLVPLAPGHTYAQAGAFANKAFEAVAAEHPRLATVERSKERRQGRL
YLDAGQNAWGKTVVAPYSLRALPHAPVSTPLSWSEVTPKLNPARFTLDSVRRRLDKVGDL
FAPALAGGQTLPPA
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
ttgggtacctaccgcgccaagcgtgacttctccctcacctcggagcccgctccggaagtc
ccggctccgcgcggtgaagggggccccatcttcgtggtgcacaagcacgacgccacccgg
ctgcactatgacctgcggctggagatcgacggcgtgctggtgagctgggccattcccaag
ggccccagctacgacccggccgacaaacggctcgccgtccagaccgaggaccaccccctg
gcctacgcgaccttcgagggccgcatccccgatggggcctatggggcgggagactcgctc
ctctgggaggagggcaccttcgacaccgtgccgccgggccaggcctccgagcagctcgcg
cgcggccggctgcacgtggtgctgcacgggcacaagctcgagggcgggtggcacctcatc
cgcacgcgccccatgggcaagaaggcgcagtggctgtgcttcaaggccaaggatggcacc
gagcagcccggctacgacgtcaccgtggagcaccccgagtccgtgaagtccggccagagc
gccacccgcgggcccggccgccgcacccggcgcaccgccgcccaacgtgccccggccaaa
cccgtgcgtgcctcccgtcccgctcgcaccaaggggagcgcccgcacgcccgaggcgctg
ctcggcaaggtatggccccccatgctggccacgctggcccaggtggatgccactgcggac
gccgactggcgcttcgaggtgaagtacgacggcttccgcgccatcgccgccttccagggc
ggccgcatcgccctgcaatcgcgcaatgggaatgatctctcctcgcgcttccccaccatc
ttccaggccctggaggcgctcggggagcacgaggccgtggtggacggggagatcgtcgcc
ctggatcccaagggccgctcgcgcttccagctgctcggcaagggcgtcgaggagcggtac
gtcatcttcgacgtgctgtggctggagggggaggatgtccgctccctgccgctggaggag
cgccgggcgaggctggagcggctgctcgagggcgtgaagcctccgctggaaatcgccgag
caggtgaagggcagcgcgaagcagtcgctgtcgcaggcgaagcggcgcgggctggagggc
gtcatggccaagcgcgtgggcagcccgtacaccccgggccgcggcgcggactggctcaag
ctcaaggtgcaggccaaccaggaggtcgccatcgtgggcttcacgcccatggccaacgag
cggccggagctgggctcactcctggtggcggtgcgcgagggcgacacctggaagtacgcg
ggcaaggtgggcacgggctactccacgaaggtgcggcgcgagctgcgcacgctcctggcc
cgtgacgtggtgaagaagtctcccgtgaaggacgctccgtacgtgcgagacgccctgcac
aacgaggaggccttctgggtgaagccccgctacgtggcccaggtggccttcaccgagtgg
acggaggatggccggctgcgccacccgtccttccaggggctgcgcagtgacaagcgtccc
gaggagtgcgtgagggagaagccgcgcagcacgcccgtgcgtgccacccgggggccgcac
cggcgcaccgggacgaagacgcgccaggcaacgcgcgccgcgggcaggacggccgtggcc
cgcaagcaggccacccgggctcccagccccgtggcgcccgtggtgctcacccatggcgag
cgggtgctcttcccccagaagggcttcaccaaggcggacgtgttcgcctacttccgggac
gtggcgccgctgatggtgccggcgctcaccggccgcccgctcgcgctgcagcagtggcct
cgcggcgtggacgagcccggcttcttccgccagggggtgcagggcacgccggactggctc
accaccacgtgcatccaccacgaggcccgctccctcccccatgtggtggtggaccggccc
gagtccctgctgtggctcgccaaccagtccgccctcaccctgcacatctggtccagccgg
gtggagcacctggaggagccggactgggtggtgttcgatctcgaccccgggccggcggga
accttcgatgacctcatccagctgacgctctcgctgcggcgctacctggaggggctgggg
ctggccagcgtgcccaagacgtccggcaagcggggcctgcacgtgctggtgccgctcgcg
cccgggcacacctacgcgcaggcgggggccttcgccaacaaggccttcgaggccgtcgcc
gccgagcacccgcggctggccaccgtcgagcgctccaaggagcggcgtcagggccggctg
tacctggacgcggggcagaacgcctggggcaagacggtggtggcgccctactccctccgg
gccctgcctcacgcgcccgtgtccacgcccctctcctggtccgaggtgacgccgaagctc
aaccccgcgcgcttcaccctggacagcgttcgacggcgcctggacaaggtgggggacctg
ttcgccccagcgttggctggtggacagacgcttccacccgcttga

DBGET integrated database retrieval system