KEGG   Archangium gephyra: AA314_03609Help
Entry
AA314_03609       CDS       T03948                                 

Definition
(GenBank) Multimodular transpeptidase-transglycosylase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
age  Archangium gephyra
Pathway
age00550  Peptidoglycan biosynthesis
age01100  Metabolic pathways
age01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:age00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AA314_03609
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AA314_03609
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:age01003]
    AA314_03609
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:age01011]
    AA314_03609
Enzymes [BR:age01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     AA314_03609
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AA314_03609
Glycosyltransferases [BR:age01003]
 Polysaccharide
  Bacterial polysaccharide
   AA314_03609
Peptidoglycan biosynthesis and degradation proteins [BR:age01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   AA314_03609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB S1 PRIMA1
Motif
Other DBs
NCBI-ProteinID: AKJ01983
UniProt: A0A0G2ZK37
LinkDB All DBs
Position
complement(4396387..4398975)
Genome map
AA seq 862 aa AA seqDB search
MSSQPSSLPPAPPPAPPAPPARPSLGARLWRWTKRLLVLGAVGVVLLVLTILGGYLYYSR
ELPSVEALRNYSLPQVTKVRCADGSICSEFFQPQGRRTVVDIKELPPHVRNAFLAAEDAD
FYKHEGLDIFGIIRAAVKNLIPGSRKSGASTITQQVVKNMLLTPERSLARKIREWILTPR
VEQALTKDQILGLYINQSYYGQGRDGIEEAALYYFGKQAKHLNIGEAAVLAGTVQSPNRI
NPEKNIVKAKQRQRYVLGQMAGQGFVPQAIVDKEMDKPIVLSPRPPPEVGSYYAEEIRRT
LVARYGGDAVLTGGLRVDIAMDPKLQVLADEAVRKGLEAVDRRQGYRGPVGTLEPARFEQ
LKPLLAKQIEEAGRRQKEGAYVADLASLAQSPTTPPPPEQAPAVVTETEQEEEARLSADE
KLALAVQLQPLKEGLKVHGFVSQVDDTGKKARVELVGRAAELTFSTVTWARFKGKGAPAK
MSDVMKPGDIVRVRITRVTPSPALLEATLDQVPLVQGGLVVINPRNRYVVALVGGYDFAA
SPFNRATQARRQPGSSFKPFLYGAALGSGRFTPISTVNDAPEAIRDPYTGKTWKPQNYDR
SFDGPMTLRQALTKSKNTVSVRLIEAITPATAIDFARRAGIRSELPENLTLALGTGEVTL
LEAANAYATLQANGRYAEPLMILKVADAQGKVLEEHQPAFEETLPPAVAYLTTSLMRSVV
EEGTARAVTELNRPAAGKTGTANESRDTWFSGYTADWVASAWVGFDDHSPLGSSETGGRA
PLPIWLEFMRAAHEGLPSREFEVPPGVVQVRIDPVTGLLAGNSVPGRLESFLDGTQPTAE
APPPGHVSPSDFFLQEGSRGGL
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccagccctcttcccttcctcccgcccctcctccggcgcccccggctcctccg
gcccgtcccagtctgggcgcccggctgtggcgctggacgaagcggctcctcgtcctcggc
gccgtgggcgtcgtgctgctcgtgctcaccatcctgggcggatacctgtactacagccgg
gagctcccctcggtggaggcgctgcgcaactacagcctgccccaggtcaccaaggtgcgc
tgtgccgacggctccatctgctccgagttcttccagccgcaggggcgccgcaccgtggtg
gacatcaaggagctgcctccccacgtgcgcaacgccttcctcgccgccgaggacgccgac
ttctacaagcacgagggtctcgacatcttcggcatcatccgcgccgcggtgaagaacctc
atccccggcagccgcaagtccggtgcctccaccatcacgcagcaggtggtgaagaacatg
ctgctcacgcccgagcgcagcctcgcgcgcaagattcgcgagtggatcctcaccccacgc
gtggagcaggccctcaccaaggatcagatcctcggcctctacatcaaccagtcctattac
gggcagggccgcgatggcatcgaggaggccgcgctctactacttcggcaagcaggccaaa
cacctgaacatcggtgaggccgcggtgctcgcgggcaccgtacagtcgcccaaccgcatc
aacccggagaagaacatcgtcaaggccaagcagcgccagcgctacgtgctggggcagatg
gccgggcagggcttcgttccccaggcgatcgtggacaaggagatggacaagcccatcgtc
ctctccccgcggccgccccccgaggtgggctcctactacgccgaggagatccgccgcacg
ctggtggcccgctacggcggtgatgccgtgctcaccggcggcctgcgcgtggacatcgcc
atggatcccaagctccaggtgctcgccgacgaggccgtgcgcaaggggctggaggccgtg
gaccggcgccagggctaccgcggccccgtgggcacgctggagcccgcgcgcttcgagcag
ctcaagccgctcctcgccaagcagatcgaggaggccggccgccgccagaaggaaggcgcc
tacgtggccgacctcgcctcgctcgcgcagtcccccaccacgcccccgccgcccgagcag
gcccccgcggtggtcaccgagaccgagcaggaggaagaggcccggctctccgccgacgag
aagctcgcgctcgccgtgcagctccagcccctcaaggagggcctgaaggtccacggcttc
gtctctcaggtggatgacacgggcaagaaggcccgcgtggagctggtgggccgcgccgcg
gagctcaccttctccaccgtcacctgggcgcgcttcaagggcaagggcgcccccgcgaag
atgtccgacgtgatgaagcccggtgacatcgtccgggtgcggatcacccgcgtcacgccc
tcgcccgcgctgctcgaggccacgctggaccaggttccgctcgtgcagggcggcctcgtc
gtcatcaacccgcgcaaccgctacgtggtggcgctggtgggcggctacgacttcgcggct
tcgcccttcaaccgcgccacccaggcccggcgccagcccggctcgtccttcaagcccttc
ctctacggcgccgcgctcggcagcggccgcttcacccccatcagcacggtgaacgacgcc
cccgaggccatccgggatccgtacaccggcaagacgtggaagccgcagaactacgaccgc
tccttcgacggccccatgacgctgcgccaggcgctcaccaagtccaagaacaccgtgtcc
gtgcgcctcatcgaggcgatcaccccggccaccgccatcgacttcgcccgccgcgcgggc
atccgctcggagctgccggagaacctcaccctggcgctgggcaccggcgaggtcaccctg
ctggaggccgccaacgcctacgccaccctgcaggccaacggccgctacgccgagccgctg
atgatcctcaaggtggcggacgcgcagggcaaggtgctcgaggagcaccagccggccttc
gaggagacactgcccccggcggtggcctacctcaccacgtcgctgatgcgcagcgtggtg
gaggagggcacggcccgcgcggtgacggagctcaaccgtcccgccgccggcaagacgggc
accgccaacgagagccgcgacacctggttctccggctacaccgccgactgggtggccagc
gcgtgggtgggcttcgatgaccactcgcccctgggcagctccgagacgggtggccgcgcc
ccgctccccatctggctggagttcatgcgcgccgcccacgagggcctgccctcgcgcgag
ttcgaggtgcccccgggtgtggtgcaggtgcgcatcgaccccgtcaccggcctgctcgcg
ggcaactccgtgcccggccggctcgagtccttcctcgacggcacccaacccaccgccgag
gcgcccccgcccggccacgtcagcccgagcgacttcttcctccaggaaggtagccggggg
ggtttgtga

DBGET integrated database retrieval system