KEGG   Archangium gephyra: AA314_03787Help
Entry
AA314_03787       CDS       T03948                                 

Definition
(GenBank) plectin 1 isoform 8
Organism
age  Archangium gephyra
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AKJ02161
UniProt: A0A0G2ZKR7
LinkDB All DBs
Position
4632809..4637485
Genome map
AA seq 1558 aa AA seqDB search
MPRYIFAESLFARRRVLEVDAVATTGGESARFLLERGARTVVACDADLAAVAAAQKAHGS
ASLRYRANIYDDLEPGSFDLVLVADLAPYVRAPMLLAELARLVSRQGYLIGGLRNTAGLA
LWQLMDVEEGVPPTYGQLLDALSPHFPNVEVATQSPVLGYQLAFEKGDGLQVDGTLIRGS
EAAYYVVVAGAEPARIVDPTWVQLPPEPLAFTRGKLDEVAQRAKGWEERTGRLKESLTRL
RAELTDRENEVTQLKPALELTRDEVARLTAQLEQARGTPESTRERDELSSRLRRTELELQ
VALERVADADRRLGQQRLELEAAERSRKEAEVQTLGSQETLRLERARREELNTTLEESRE
RLTQAYTQLRELQDEMAGLRVEREKDRLSAERAREQSEELRRQVEAARERELRLAEQYST
SLAAVELLKSDVARAEQARQTSESLLRSRDADLARLAREVEDGSRRVSAAEAARRDAEVS
LTAREAEWRGLETELTAARAELERLTAEVEARTRSEENVRSAAARLEQELHEARGSLESL
EEERVRSAAELEETIEEERQRAETRVAQERARTEQAEAEAAREKAAREEQELRAEGLENQ
VRVEAGAREEASRALAELEAQRQQWADERGALRRRVVEVEATLSDLERVRASDVESITRL
DAALKATQGSITAEQQARARADEAREQALAELELEREGRARLEEAVAQSQARLEAEHQRL
EETREALSTVRAELKSERQQRVQVEEERTRLQAGLEEERQQRARVEASLAEVQAGLAAER
QGSTGLASELAELQAGLDVERQQRLQVEESLEQVRAELKAARQRSTGLESELALAQAGLE
SAWQAHGASKESITRVLAELETERRERSGVEASLTAVRAELEAERANRTRTEESLELAWT
QLEAERRQLAEAEVSLVSEREKAEALLAQVRAGLEVERDALRLDLDRARELSEAALEETR
RKLEDERAGREALAQSLAEARADLESSRAGADERERARLEVLEEARRESSALRAELESAR
REGEALDTSLAEQKRLVEELRATLEEERASQKALKESLAEARAREEAISTERDTRKRDAL
EVRMELEGLRDDLAKKDQELEALRAQVAQLEATRFQAHQASMALQQAHQGLRDRDMHIAH
LQKEVSETRARLAAEHEQMELVTLQLESARRIAGKAPSLESALEEERAALGSVREALETA
RGGLETAREELETLRAALARSQEEQRAERERVAEARRSADELETRLAEARRELETRLAEA
RSELEATKAKQAELEAQADEAGLRAREREAAVEARLAELEAQAEEARREAREQEAAARQR
QSGLEAQRAELEAKLAGLEARAEEAERRFREREGSAQAIQEQFAKLEMEKGTLVSERERL
NSDLTVARAARIRLEGRVTALEAASAEAVKFLDAERAEKARAAQALADRIQMLETERTGL
RERIELLQARKPVSDSEAILEMSEELERLQGEFDALQSTLGERELVLAEQKRRLEEQEAE
LASLKRLSARKGADTVQDIYARANAELNAVKNELLRRPKGSTPSSPAPASTQKPDDPG
NT seq 4677 nt NT seq  +upstreamnt  +downstreamnt
ttgccccggtacatcttcgcggagagcctcttcgcacgccgtcgcgtgttggaggtggac
gcggtcgccaccaccggcggcgagagcgcgcgcttcctcctggagcgcggcgcccgcacc
gtcgtggcctgtgacgcggacctcgcggccgtggcggcggcccagaaggctcatggcagc
gcctcgctgcgctaccgcgccaacatctacgacgacctcgagcccggcagcttcgacctg
gtgctggtggccgatctcgccccctacgtgcgcgcgcccatgctcctggccgagctggca
cggctcgtgagccgccagggctacctcatcggcggcctgcgcaacaccgccgggctcgcc
ctctggcagctcatggacgtggaggagggcgtgccgcccacgtacgggcagctgctcgac
gcgctctccccgcacttcccgaacgtggaagtcgccacgcagtcgcccgtgctgggctac
cagctcgccttcgagaagggcgatggcctccaggtggacggcaccctcatccggggcagc
gaggccgcctattacgtggtggtggccggcgccgagcccgcccgcatcgtggaccccacc
tgggtgcagctgccccccgagccgctcgccttcacccgcggcaagctggacgaggtggcc
cagcgcgccaagggctgggaggagcgcaccggccgtctcaaggagtccctcacccggctg
cgcgcggagctgaccgaccgcgagaacgaggtgacgcagctcaagccggccctggagctc
acccgcgacgaggtggcccgcctcaccgcccagctggagcaggcgcgtggcaccccggag
agcacccgcgagcgcgatgagctgtcctcccgcctgcgccgcaccgagctggagctgcag
gtggccctggagcgcgtggccgacgcggaccggaggcttggccagcagcggctggagctg
gaggccgcggagcgctcccggaaggaggccgaggtccagaccctgggctcccaggagacg
ctgcggctggagcgcgcccgccgcgaggagctgaacaccaccctggaggagtcgcgcgag
cgtctcacccaggcctatacccagctgcgcgagctgcaggacgagatggccgggctgcgc
gtcgagcgcgagaaggaccggctctcggcggagcgcgcgcgggagcagtccgaggagctg
cggcggcaggtggaggcggcccgcgagcgcgagctgcgtctggccgagcagtattcgacg
tcgctcgccgcggtggagctgctcaagtcggacgtggcccgggccgagcaggcccgccag
acgtccgagtccctgttgcgctcgcgtgacgcggacctggcgcgtctggcacgcgaggtg
gaggacggctcccggcgcgtgtcggcggcggaggcggcccggcgtgacgcggaagtgagc
ctgacggcccgtgaggccgagtggcgcgggctggagacggagctcacggcggcgcgtgcc
gagctggagcggctcacggccgaggtggaggcccggactcgctccgaggagaatgtccgc
tcggcggcggcccggctcgagcaggagctgcacgaggcccgcggcagcctggagtcgctc
gaggaggagcgggtccgctcggccgcggagctggaggagaccatcgaggaggagcgccag
cgcgcggagacgcgggtggcgcaggagcgggcgcggacggagcaggccgaggccgaggcc
gcccgcgagaaggccgctcgcgaagaacaggagctgcgcgccgaggggctcgagaaccag
gtgcgcgtggaggccggcgcacgggaggaggcctcgcgggccctcgccgagctggaggcc
cagcggcagcagtgggccgacgagcgcggggccctccggcggcgcgtggtggaggtcgag
gcgacgctctcggacctggagcgggtgcgggcctcggacgtggaatcgatcacccggctc
gacgcggcgctgaaggcgacgcagggctccatcacggcggagcagcaggcgcgggcccgg
gccgacgaggcgcgcgagcaggcgctggcagagctggagctggagcgcgaggggagggcg
cggctggaggaggccgtggcccagtcccaggcccggctggaggcggagcaccagcggctc
gaggagacccgcgaggcgctctcgaccgtccgcgccgagctgaagtcggagaggcagcag
cgcgtccaggtggaggaggagcgcacgcggctccaggccgggctcgaggaggagcgccag
cagcgggcccgcgtggaggcctccctggcggaggtccaggccgggctcgccgccgagcgg
caggggagcaccggactcgcgtccgagctggcggagctgcaggccgggctcgacgtggag
cgtcagcagcggctccaggtggaggagtccctggagcaggtccgggccgagctcaaggcc
gcgcggcagcggagcaccgggctggagtccgagctggccctcgcccaggccgggctcgag
tccgcgtggcaggcgcatggcgcgtcgaaggagtccatcacgcgggtgctcgccgagctc
gagacggagcgtcgggagcggagcggggtggaggcgtcgctcacggccgtccgggccgag
ttggaggcggagcgcgcgaacaggacgcgcaccgaggagtcgctggagctcgcctggacg
cagctggaagccgagcggcggcagctcgccgaggccgaggtgtcgctcgtgtcggagcgc
gagaaggccgaggcgctcctggcccaggtgcgcgccgggctcgaggtggagcgcgatgcg
ctgcgcctggatctggatcgcgctcgcgagctgtccgaggcggccctcgaggagacccgg
cgcaagctggaggatgagcgcgccggacgcgaggccctggcgcagtcgctggccgaggcc
cgcgcggacctggagtcctcccgggcgggcgcagacgagcgcgagcgggcccggctcgag
gtgctggaggaggcccggcgggagtcctcggcgctgcgcgcggagctggagtctgcccgg
cgcgagggcgaggcgctggacacgtccctggcggagcagaagcggctcgtcgaggagctg
cgggccaccctggaggaggagcgcgcgagccagaaggccctgaaggagtccctcgcggag
gcccgggcgcgcgaggaggccatctccaccgagcgcgacacccgcaagcgtgacgcgctg
gaagtccggatggagctggaaggcctccgggacgacctcgcgaagaaggaccaggagctg
gaggcgctgcgggcccaggtggcgcagctcgaggccacccgcttccaggcgcaccaggcc
tccatggcgctccagcaggcgcaccaggggctgcgggaccgggacatgcacatcgcgcac
ctccagaaggaggtgtccgagacacgggcccggctcgccgcggagcacgagcagatggag
ctcgtcaccctgcagctcgagtcggcccggcgcatcgcgggcaaggcgccctcgctcgag
tcggccctcgaggaggagcgcgcggcactcgggagcgtccgcgaggcgctggagacggcg
cgcggtgggctggagacggcccgggaggagctggagacccttcgcgccgcgctggcccgt
tctcaggaggagcagcgggcggagcgggagcgggtggccgaggcgcggcgctcggcggac
gagctggagacacggctggcggaagcccggcgcgagctggagacacggctggcggaagcc
cggagcgagctggaggccacgaaggcgaagcaggccgagctggaggcccaggcggacgaa
gccggactgcgggcccgggaacgggaggccgctgtcgaggcgcggctggccgagctggag
gcccaggcggaggaggcccggcgggaggcccgggagcaggaggccgccgctcggcaacgg
cagtccgggctggaagcgcagcgggccgagctggaggcgaagctggccgggctggaggcc
cgggcggaggaggcggagcgccggttccgggagcgcgagggctccgcgcaggccatccag
gagcagttcgccaagctggagatggagaagggcacgctcgtctccgagcgcgagcggctc
aactcggacctcacggtggcgcgtgcggcgcgcatccggctggagggccgggtgacggcg
ctggaggcggcctccgccgaggcggtgaagttcctcgacgccgagcgcgccgagaaggcc
agggcggcccaggcgctggccgaccgcatccagatgttggagacggagcggaccgggctg
cgcgagcgcatcgagctgctccaggcgcgcaagccggtgtcggactccgaggccatcctg
gagatgtccgaggagctggagcggctgcagggcgagttcgacgccctccagtccaccctg
ggcgagcgcgagctggtgctggccgagcagaaacgacggttggaggagcaagaggccgag
ctggcctctctcaagcggctctccgcccgcaagggggcggacaccgtgcaggacatctac
gctcgggccaatgccgagctgaacgcggtcaagaatgagttgcttcgccgtccgaagggg
agcacaccctcttctccggcacccgcgtccacccagaaacccgatgacccgggctga

DBGET integrated database retrieval system